SecReT6
Protein ID: 126443069
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0158
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]138141..139640 [+]
Producthypothetical protein
NoteTssC
UniProt IDA3NFP3
KEGG IDbpd:BURPS668_A0158
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-196, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|126443069|ref|YP_001061164.1| hypothetical protein BURPS668_A0158 [Burkholderia pseudomallei 668]
MAARESQARSADAQLATHSDFNALLSREFKPKTEQAREAVEHAVKTLAEQALANSVTLSDDAYKSIEAII
GEIDRKLSEQINLILHHDDFQQLESAWRGLHHLVTNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWA
NAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERED
MQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|126442307|ref|NC_009075.1|:138141-139640 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGCTGCACGTGAATCTCAGGCGCGCTCCGCCGATGCACAGCTCGCTACGCACTCGGACTTCAATGCCC
TGCTGTCGCGCGAGTTCAAACCGAAGACCGAACAGGCGCGCGAGGCGGTGGAACATGCCGTCAAGACGCT
GGCCGAGCAGGCGCTCGCCAATTCTGTGACGTTGTCGGACGACGCGTACAAGAGCATCGAAGCGATCATC
GGCGAAATCGATCGAAAGCTGTCCGAGCAGATCAACCTGATTCTGCATCACGACGATTTCCAGCAGCTGG
AAAGCGCATGGCGCGGCCTGCATCATCTGGTGACGAATACCGAGACGGACGAGAAGCTCAAGATCCGCTT
CATGGACGTCTCCAAAGACGATCTGCGCCGTACGATGAAGCGATACAAAGGCGTGGCCTGGGACCAGAGC
CCGTTTTTCAAGCAGATCTACGAAGAGGAATACGGTCAGCTCGGCGGCGAGCCGTATGGATGCCTCGTGG
CCGACTACTACTTCGACCACACGCCGCCGGACGTCGATCTGCTTTCGTCGATCGGCAAGGTGGCGGCTGC
CGCGCACGCTCCGTTCATTACCGGCGCATCGCCTTCGGTACTCCAGATGGATTCCTGGCAAGAGCTGGCC
AATCCGCGCGACCTGACGAAGATCTTCACGCAGAACCTCGAATATGCGCCCTGGAATTCGCTGCGCAATT
CCGAAGATGCCCGTTATATCGGTCTTGCGATGCCGCGCTTCCTCGCACGCTTGCCGTATGGAATCAGGAC
GAATCCCGTCGACGAATTCGATTTCGAGGAATCGACGGATGGGTCCGATCATCGCAAGTACGTGTGGGCG
AATGCCGCGTATGCGATGGCGGTCAACATCAATCGCTCGTTCAAGCATTACGGCTGGTGCACGCTGATTC
GCGGTGTGGAAAGCGGCGGCGTCGTCGAGAACCTGCCTTGCCATACGTTCCCGACGGACGACGGCGGCAT
CGACATGAAGTGTCCGACCGAAATCGCGATTTCCGATCGCCGCGAAGCGGAGCTCGCGAAGAACGGCTTC
ATTCCGCTGATCCATCGAAAGAACACCGACTACGCGGCATTCATCGGAGCGCAATCGCTGCAGAAGCCGG
CCGAGTACTACGACCCGGACGCCACCGCGAACGCGAACCTGTCCGCCCGCCTGCCGTACCTGTTCGCGTG
CTCGCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGGAGCGCGAAGAC
ATGCAGCAGTGGCTCAACGAATGGATCATGAACTATGTCGACGCCGACCCGGCGAACTCGTCGCAGGAGA
CCAAGGCGCGCCGTCCGCTGGCCGCGGCCGAAGTGGTTGTCGAAGACGTGGAAGGCAATCCGGGCTACTA
CCAGGCGAAGTTCTTCCTGCGTCCGCACTTCCAGCTGGAAGGGTTGACCGTGTCGCTGCGCCTCGTCGCG
AAGCTGCCCTCGGTCAAGGAAGCGGCGTAA