SecReT6
Protein ID: 126443108
SecReT6 ID179
T6SS typei3
Gene symbolclpB
Locus tagBURPS668_A0178
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]164196..166883 [+]
Productchaperone clpB
NoteTssH
UniProt IDA3NFR3
KEGG IDbpd:BURPS668_A0178
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.80E-39, Aligned region: 244..324
AAA_2 [PF07724], Evalue: 8.80E-39, Aligned region: 622..787
AAA [PF00004], Evalue: 8.60E-21, Aligned region: 246..377
AAA [PF00004], Evalue: 8.60E-21, Aligned region: 627..711
AAA_5 [PF07728], Evalue: 5.10E-15, Aligned region: 246..324
AAA_5 [PF07728], Evalue: 5.10E-15, Aligned region: 626..745
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 454..471
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 794..867
AAA_16 [PF13191], Evalue: 2.60E-10, Aligned region: 223..267
AAA_16 [PF13191], Evalue: 2.60E-10, Aligned region: 287..324
AAA_16 [PF13191], Evalue: 2.60E-10, Aligned region: 391..412
AAA_16 [PF13191], Evalue: 2.60E-10, Aligned region: 496..534
AAA_16 [PF13191], Evalue: 2.60E-10, Aligned region: 597..669
AAA_16 [PF13191], Evalue: 2.60E-10, Aligned region: 691..710
Sigma54_activat [PF00158], Evalue: 3.40E-09, Aligned region: 242..326
Sigma54_activat [PF00158], Evalue: 3.40E-09, Aligned region: 626..725
AAA_22 [PF13401], Evalue: 6.10E-08, Aligned region: 246..327
AAA_22 [PF13401], Evalue: 6.10E-08, Aligned region: 625..649
AAA_22 [PF13401], Evalue: 6.10E-08, Aligned region: 688..713
AAA_19 [PF13245], Evalue: 1.80E-07, Aligned region: 244..272
AAA_19 [PF13245], Evalue: 1.80E-07, Aligned region: 624..648
AAA_17 [PF13207], Evalue: 8.80E-06, Aligned region: 246..285
AAA_17 [PF13207], Evalue: 8.80E-06, Aligned region: 626..664
AAA_18 [PF13238], Evalue: 1.60E-05, Aligned region: 246..307
AAA_18 [PF13238], Evalue: 1.60E-05, Aligned region: 627..658
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 246..268
Zeta_toxin [PF06414], Evalue: 2.60E-05, Aligned region: 619..666
AAA_29 [PF13555], Evalue: 3.30E-05, Aligned region: 238..265
AAA_29 [PF13555], Evalue: 3.30E-05, Aligned region: 624..651
NACHT [PF05729], Evalue: 6.00E-05, Aligned region: 246..274
NACHT [PF05729], Evalue: 6.00E-05, Aligned region: 626..653
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 246..270
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 450..499
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 624..652
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 237..266
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 626..646
AAA_14 [PF13173], Evalue: 0.00026, Aligned region: 246..326
AAA_14 [PF13173], Evalue: 0.00026, Aligned region: 625..713
DEAD [PF00270], Evalue: 0.003, Aligned region: 234..259
DEAD [PF00270], Evalue: 0.003, Aligned region: 318..330
DEAD [PF00270], Evalue: 0.003, Aligned region: 390..415
DEAD [PF00270], Evalue: 0.003, Aligned region: 626..808
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 246..272
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 306..326
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 625..661
RNA_helicase [PF00910], Evalue: 0.0039, Aligned region: 247..267
RNA_helicase [PF00910], Evalue: 0.0039, Aligned region: 627..648
T2SE [PF00437], Evalue: 0.0066, Aligned region: 236..266
T2SE [PF00437], Evalue: 0.0066, Aligned region: 622..695
NTPase_1 [PF03266], Evalue: 0.0093, Aligned region: 246..268
NTPase_1 [PF03266], Evalue: 0.0093, Aligned region: 626..648
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 246..258
Hpr_kinase_C [PF07475], Evalue: 0.0096, Aligned region: 624..644
Protein Sequence: 895 a.a.     [Download]
>gi|126443108|ref|YP_001061184.1| chaperone clpB [Burkholderia pseudomallei 668]
MCANVAYSRIHDRDMTVSRQALFGKLGYSLFRSIESATAFCKLRGNPYVELVHWLHQMLQAADGDMQRIA
RHCDIDLGELERDMVRALGELPAGASSISDFSHHIETAIERAWVLATLDFGDRRIRGAWLLAALLKTPEL
RRVLLSISSAFGRIRVDELDAMLPAWIDGSPEANETPYDNSDFGAAIPGEASSAMQQKGGGSPLEQFCLD
LTARARAGQIDPVVGRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLARAIAAGDVPPKLADARL
LSLDVGALLAGASMKGEFEARLKGVLEAAAKATLPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGT
LRTIGATTWAEYKRHIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLTRTFSRHHGVVVLDEAIRAAVKLS
HRYIPSRQLPDKAISLLDTACARVALSQHAPPRELQDVRRRLEAARVRLELLDGEQRIGLGDEAALAQSR
AEIAALEVEEQSIDACWRQQIEAAQTLLSAREAAGDAAASAIDALRELEHALSNLQGDHAFVFPEVNEAI
VADIMSDWTGIPVGRMVTDEVSAVRALPDTLAARVIGQRDALHQIGDRVQTARAGLTDPKKPLGVFLLAG
PSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVL
LDEIEKAHPDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSDLVSGLCMDEACAPDADGLCAAL
ASELLKTFPAAFLGRVTLVPYRPLAQETLSRIVRLHLDRVVTRMAENQGVALRYSDNVVDYVVNRCLVQE
TGVRLLIGFIEQHVLPLLAKLWLDSLASKHVLTRVDLDVADPAAAPAEAFALRAS
 
Nucleotide Sequence: 2688 bp     [Download]
>gi|126442307|ref|NC_009075.1|:164196-166883 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
TTGTGTGCAAACGTCGCATATTCACGAATTCACGATCGAGACATGACAGTTTCAAGACAGGCACTATTCG
GCAAGCTCGGCTACTCGCTGTTTCGCAGCATCGAATCGGCGACGGCGTTCTGCAAGCTTCGCGGCAACCC
TTACGTCGAGCTGGTGCATTGGCTGCATCAGATGCTTCAGGCCGCTGACGGCGATATGCAGCGGATCGCT
CGCCACTGCGACATCGACCTCGGCGAGCTGGAGCGCGACATGGTGCGCGCGCTCGGCGAACTGCCGGCGG
GCGCGAGCTCGATCAGCGATTTCTCGCACCACATCGAGACGGCGATCGAGCGCGCGTGGGTGCTGGCGAC
ACTGGACTTCGGCGATCGCCGGATTCGCGGCGCGTGGCTACTGGCTGCGTTGCTGAAGACGCCGGAACTC
AGGCGCGTACTGCTGTCGATTTCGTCCGCGTTCGGCCGGATTCGTGTCGACGAACTGGATGCGATGTTGC
CGGCCTGGATCGACGGCTCGCCCGAGGCGAACGAGACGCCGTACGACAACAGCGACTTCGGCGCGGCCAT
ACCGGGCGAGGCGTCGAGCGCGATGCAGCAAAAGGGCGGCGGTTCACCGCTGGAGCAGTTCTGCCTCGAT
CTCACCGCGCGAGCGCGAGCGGGGCAGATCGATCCGGTCGTCGGTCGTGAGCTGGAAATCCGCACGATGA
TCGACGTCCTGTTGCGCCGCCGCCAGAACAACCCGCTGCTGACGGGCGAGGCGGGCGTGGGCAAGACGGC
CGTCGTCGAAGGGCTCGCGCGCGCGATCGCCGCCGGCGATGTGCCGCCGAAGCTTGCCGATGCGCGCCTG
CTGAGCCTCGATGTCGGCGCGCTGTTGGCCGGGGCGAGCATGAAGGGCGAATTCGAGGCGCGCCTGAAAG
GCGTGCTGGAGGCGGCGGCGAAAGCGACGCTGCCCGTCATTCTGTTTGTCGACGAGATTCACACGCTGAT
CGGCGCGGGCGGCCAGGCGGGCACCGGAGATGCCGCGAACCTGCTCAAGCCCGCGCTCGCGCGCGGCACG
CTGCGAACGATCGGTGCGACGACGTGGGCGGAATACAAGCGGCACATCGAAAAGGATCCGGCGCTCACAC
GCCGCTTCCAGGTGTTGCAGGTTCCCGAGCCCGACGAGGCGGCCGCGATCGACATGGTTCGAGGGCTGAC
GCGAACCTTCTCGCGTCATCATGGCGTCGTCGTGCTGGACGAGGCGATTCGCGCGGCGGTCAAGCTGTCG
CATCGCTACATTCCATCCCGTCAGTTGCCGGACAAGGCGATCAGCCTGCTCGATACGGCGTGCGCGCGCG
TCGCGTTGTCGCAGCATGCGCCGCCGCGTGAGCTGCAGGACGTCCGCAGAAGATTGGAGGCTGCGAGGGT
GCGGCTCGAATTGCTCGACGGCGAGCAGCGCATCGGCCTTGGCGACGAAGCCGCGCTCGCGCAGTCTCGC
GCGGAAATCGCCGCGCTCGAGGTGGAGGAGCAATCGATCGACGCTTGCTGGCGGCAGCAGATCGAGGCCG
CGCAGACGCTGCTCAGCGCGCGCGAGGCGGCGGGCGACGCTGCGGCGAGCGCGATCGACGCGCTGCGCGA
GCTGGAGCATGCGCTGTCGAACCTGCAAGGCGATCACGCGTTCGTTTTCCCCGAGGTCAACGAAGCGATC
GTCGCGGATATCATGTCCGACTGGACCGGCATTCCGGTCGGCAGGATGGTGACGGACGAAGTGTCCGCCG
TGCGCGCCTTGCCGGACACGCTCGCCGCCCGCGTGATCGGTCAACGCGATGCGTTGCATCAGATTGGCGA
TCGGGTGCAAACGGCGCGCGCCGGATTGACCGATCCGAAGAAGCCGCTCGGCGTGTTCCTGCTCGCGGGG
CCGTCGGGCGTCGGCAAGACGGAGACGGCATTGGCGCTTGCCGAGGCGCTGTACGGCGGCGAGCAGAATC
TCATCACGATCAACATGAGCGAATATCAGGAGGCGCATACGGTATCGGGGCTGAAGGGCGCCCCGCCGGG
TTACGTCGGATACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCAGGCGTCCGTATTCCGTCGTGCTT
CTCGACGAGATCGAGAAGGCGCATCCCGACGTCCACGAGATGTTCTTCCAGGTATTCGACAAGGGCTACA
TGGAGGACGGCGACGGGCGCTATATCGATTTTCGCAACACGACGATTCTTCTCACCAGCAATGCAGGCTC
CGACCTCGTGTCCGGACTGTGCATGGACGAGGCTTGCGCTCCCGACGCGGACGGCCTTTGCGCCGCGCTC
GCTTCCGAATTGCTCAAGACGTTTCCCGCGGCGTTTCTCGGGCGCGTGACGCTGGTGCCCTATCGTCCGC
TCGCGCAGGAAACGCTATCGCGCATCGTCCGGCTGCATCTGGACCGAGTGGTGACGCGAATGGCCGAGAA
TCAGGGTGTCGCCCTGCGTTATTCGGACAATGTCGTCGATTACGTCGTCAATCGCTGCCTCGTGCAGGAA
ACGGGGGTGCGCTTGCTGATCGGCTTCATCGAGCAGCACGTGTTGCCGCTGCTCGCGAAGCTCTGGCTGG
ATTCGCTTGCGTCCAAGCACGTGCTGACACGCGTCGACCTCGACGTGGCCGATCCCGCCGCGGCCCCGGC
CGAAGCGTTCGCGCTGCGCGCTTCATGA