SecReT6
Protein ID: 126443128
SecReT6 ID180
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0328
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]294209..295474 [-]
Producthypothetical protein
NoteTssL
UniProt IDA3NG63
KEGG IDbpd:BURPS668_A0328
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 46..256
OmpA [PF00691], Evalue: 2.70E-17, Aligned region: 315..413
Protein Sequence: 421 a.a.     [Download]
>gi|126443128|ref|YP_001061334.1| hypothetical protein BURPS668_A0328 [Burkholderia pseudomallei 668]
MHHPDISAPAPTFDSVAATFARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALADMPERLDRDD
IPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAQSASGNLGTWISEGLATSFH
EDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQRGPV
SVALSPHWQPGPRSRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPA
ELRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIAKVPGKVTVRGY
TDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRVEITVA
R
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c295474-294209 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
GTGCATCATCCGGACATATCGGCTCCGGCCCCGACCTTCGATTCCGTCGCGGCGACGTTCGCGCGGCGCG
AGCCGGCGCCTGCGCCGGCCGGCGAGCCGCCCGCCGCGCGCCTCGCCGCGATCAGGCTCGCCCGCAACCC
GCTGCTCGAAGCCGCGCGCGTGCTGCTGCGGGCGCTCGCCGACATGCCCGAGCGGCTCGATCGCGACGAC
ATTCCGCAATTGCGCCTGCTGCTGGAACAGGAGGTGCGCCTGTTCCAGCGGCTCTGCGAACAGGCGAACA
TCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCGGCGATGCAGAC
GTCGTGGGCACAATCGGCGAGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTCGCGACGTCGTTCCAC
GAGGATCGCCAGGGCGGAGACAAGGTCTATCTGCTGATCGGCCGGCTGATGAATTCCCCGCACGAGCACA
TCGACCTGCTCGAAGTCATCTATCGAATCTTGAGCCTCGGCTTCGAGGGCCGCTACCGTTACGAAGCCGA
CGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCATCGCAGCGCGGGCCGGTG
TCGGTCGCGCTGTCGCCGCACTGGCAGCCCGGCCCCCGCAGCAGGAGCGCGCCGTTTCGCGATTTCCCCG
CGTGGGTCACGGCCGCCGTGCTGTCGCTGATCGCGCTCGGGCTGTTCGGCTGCTTCAAGTACGCGCTGTC
GACGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGGCGCCGCCCGCCGCGCCGGCC
GAGCTGCGCCTCGCGACGCTGCTCGCCGGCGAGATCGCGGCGGGCACGCTCAGCGTCGAGGAAAACGCGC
GCCGCAGCTCGGTGACGTTCCGCGGCGACGCGATGTTCGCGCCGGGCGCGGCCGGCGTAAACCCGGCGAT
GGGGCCGCTCATCCGGAAAATCGCGGCCGAGATCGCGAAGGTGCCGGGCAAGGTGACGGTGCGCGGCTAC
ACCGACAATCAGCCGATCAAAAGCCGCCAGTTCGCGTCGAACGAGGCGCTATCCGAAGAGCGCGCGACGC
AGGTCATGCAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCTCGGCAAGGGCGGCGC
CGAGCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTCGAAATCACGGTCGCG
CGCTGA