SecReT6
Protein ID: 126443135
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2968
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2825341..2825859 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDA3NNN8
KEGG IDbpd:BURPS668_A2968
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-38, Aligned region: 14..160
Protein Sequence: 172 a.a.     [Download]
>gi|126443135|ref|YP_001063959.1| putative lipoprotein [Burkholderia pseudomallei 668]
MRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSPIVLKVFQLKTASAFESADF
FSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNL
YRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 519 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2825859-2825341 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCGACCGCGGTTCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGCTTGCCGGATGCGGGGCGACCG
AGCGTTCCGTTGCGGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCG
CAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTC
TTCTCGCTGCAGGACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGC
GCCCGGGGGATGCGCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGA
ATATCGCGTGCTCGAGAAGAACCGCTGGCGGATGACGGTGCCGCTGCCGCGCGCGAAGCAACTGAACCTG
TACCGATTCTGGCAAACCTCGCCGGGCGAGATGAAGCTGCAAGTCGCCGTGAAGAACGGCGGCATCGGCC
TCGGCGGCGATTCGCGAGTACGCCAATGA