SecReT6
Protein ID: 126443149
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2135
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2075116..2075913 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA3NLA8
KEGG IDbpd:BURPS668_A2135
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-25, Aligned region: 46..208
Protein Sequence: 265 a.a.     [Download]
>gi|126443149|ref|YP_001063129.1| hypothetical protein BURPS668_A2135 [Burkholderia pseudomallei 668]
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQARADVRWDYAP
DALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPG
QHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITD
AREAPLNLPPPGARAWTALDSGAKTLALPSADANDGGSGKRDKRGNAAARAPRKQ
 
Nucleotide Sequence: 798 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2075116-2075913 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAACGCACGACACATTGCCCCGCCGGCCGCGACGCGCGCGCGCCGGCCGATGCAGCCCGGCCGGCCGT
CATGGCCGTCGCGAACGTATCGCGCATGCGCGGCTCGCACATGCGCTGCCGTGCTCGTCGCGCTCGCCGC
CCTCGCCGGCTGTGCGGCCCGCGTCACCGAAGAGCAGGCGCGCGCCGACGTGCGATGGGACTACGCGCCC
GACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATACCTGAACGCGCCGCACACGCTGT
TGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTCGCCGACGATCCGGACCGGCTGCG
CATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACCCGCTACGTCGTCGCGCCCGGC
CAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCGGCATCGTCGCCGGCTACTACG
ACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCATCGACAAGCGCGGCTGGTTCTC
CTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTCGGCGCGCAGAGCATCACCGAC
GCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGACGGCGCTCGACAGCGGCGCGA
AAACCCTGGCGCTGCCGAGCGCCGACGCGAACGACGGCGGCAGCGGCAAGCGCGACAAACGCGGCAACGC
CGCCGCCCGTGCGCCGCGCAAGCAATGA