SecReT6
Protein ID: 126443230
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2128
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2063107..2064129 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3NLA1
KEGG IDbpd:BURPS668_A2128
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-81, Aligned region: 11..311
Protein Sequence: 340 a.a.     [Download]
>gi|126443230|ref|YP_001063122.1| hypothetical protein BURPS668_A2128 [Burkholderia pseudomallei 668]
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDVERIDKADDGG
YRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPLLFDAWLKHRLALRIVEERDE
HALRPLYALAGVNARIARDAGLHEHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPCVPQWLPIP
DDQRTRVGTRAHRLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAV
DVVVRVRARDAAPARCGGRAWSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2063107-2064129 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCCTGCTCTAGAACCCGTTCTGCTCGGCGAGGCGAAGCACTTCGCGTATTTCCAGGCGATCCGGCTGC
TGCGGCGCATCGCGCGCGAACGGCGCGGCGACGCCGCGGGGCGGCCCGACGCGCCGCTGCCGATCCACAC
GCGGCCGAATCTCTCGCTGTCGTTTCCGGACACCGACGTCGAGCGCATCGACAAGGCCGACGACGGCGGC
TACCGGGTCGTCGCGAACTTCTTCGGTCTGTACGGCGTGTCCTCGCCGCTGCCGACGTTCTACACCGAGG
ACCTGATCGACGAAGCGTTCAGGGGCCGCCACGCGGCGCGCGGCTTTCTCGACGTGCTGCATCGCGCGCT
CTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGGCTGGCGCTGCGGATCGTCGAGGAACGCGACGAA
CACGCGCTGCGCCCGCTCTACGCACTCGCGGGCGTCAACGCGCGCATCGCGCGCGACGCGGGCCTGCACG
AGCACGCGCTGCTGCGCTACGTCGGGCTGCTCAGCCAGCGGCCGCGCTCCGCGGCCGGTCTGCGCGCGCT
GCTCGCCGACGCATTCGCGCCCGCGACGGTCGACATCGAGCCGTGCGTGCCGCAATGGCTGCCGATTCCG
GACGACCAGCGCACCCGCGTCGGCACGCGCGCGCACCGGCTCGGCGCCGACGCGCGGGTCGGCGCGCGCA
TGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTCGGCGACGTGCCCGGCCCGCTGTTCCGCGCGCTGAT
GCCGGGCGGCGATGCGTTTGCCCGGCTGCGCTTGCTCGTACGCCTGTATCTGACCCAACCGTTCGCCGTG
GACGTCGTGGTGCGCGTGCGCGCGCGCGACGCGGCCCCCGCGCGCTGCGGCGGCCGCGCGTGGTCGCGCG
TCGGGCTCGACGCGTGGCTGGGCGGCCCGAGCGCGGAACGCGCGGCGTCGCCCGAATTCCGTCTTCCGAC
TTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA