SecReT6
Protein ID: 126443370
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2129
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2064116..2067136 [+]
ProductATP-dependent Clp protease, ATP-binding subunit ClpB
NoteTssH
UniProt IDA3NLA2
KEGG IDbpd:BURPS668_A2129
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 226..244
AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 685..852
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 227..336
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 691..809
ClpB_D2-small [PF10431], Evalue: 5.20E-14, Aligned region: 857..929
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 227..245
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 690..804
AAA_22 [PF13401], Evalue: 1.00E-09, Aligned region: 224..310
AAA_22 [PF13401], Evalue: 1.00E-09, Aligned region: 409..439
AAA_22 [PF13401], Evalue: 1.00E-09, Aligned region: 689..784
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 37..117
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 269..307
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 419..468
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 661..726
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 755..784
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 852..891
Zeta_toxin [PF06414], Evalue: 3.10E-06, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 3.10E-06, Aligned region: 305..353
Zeta_toxin [PF06414], Evalue: 3.10E-06, Aligned region: 684..731
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 225..302
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 461..502
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 686..711
Clp_N [PF02861], Evalue: 1.10E-05, Aligned region: 28..75
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 116..131
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 220..247
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 435..467
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 490..519
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 590..605
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 688..722
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 891..915
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 219..253
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 690..726
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 276..374
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 689..711
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 221..239
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 689..806
AAA_17 [PF13207], Evalue: 0.00023, Aligned region: 227..249
AAA_17 [PF13207], Evalue: 0.00023, Aligned region: 690..726
ResIII [PF04851], Evalue: 0.00033, Aligned region: 210..246
ResIII [PF04851], Evalue: 0.00033, Aligned region: 292..307
ResIII [PF04851], Evalue: 0.00033, Aligned region: 661..724
TIP49 [PF06068], Evalue: 0.00056, Aligned region: 226..251
TIP49 [PF06068], Evalue: 0.00056, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.00056, Aligned region: 690..725
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 223..245
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 288..313
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 404..484
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 690..837
NACHT [PF05729], Evalue: 0.0014, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0014, Aligned region: 690..711
Torsin [PF06309], Evalue: 0.0046, Aligned region: 648..716
AAA_14 [PF13173], Evalue: 0.0064, Aligned region: 278..328
AAA_14 [PF13173], Evalue: 0.0064, Aligned region: 689..772
AAA_18 [PF13238], Evalue: 0.0065, Aligned region: 228..245
AAA_18 [PF13238], Evalue: 0.0065, Aligned region: 691..732
Protein Sequence: 1006 a.a.     [Download]
>gi|126443370|ref|YP_001063123.1| ATP-dependent Clp protease, ATP-binding subunit ClpB [Burkholderia pseudomallei 668]
MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARLCDEPSADVALLLRACGADAARLRRQ
ADAALDARPAGDGGRPAFAPSLLALLQDAWLIASLELGDTHIRSAAVLAAAVARAARQPSPGGDDVLQSL
RKDALVARFASGACARSIESRASGALDAAPGEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIR
QIVDILARRRKNNPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQR
LKRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSEYKKYFEKDAA
LARRFQPVKLDSPDVATSVMILRGLKERYQDAHGVTIRDDALVAAAELSARYITGRQLPDKAIDLLDTAC
ARVKVRQQTKPAALEDAQRAIQALERERRALRDELAERCAPDTPRVADIDRELAALSARAGALRDAWAAQ
REAAQALVDARRACRAAADATDAAGTTGTAHAGELADSADVSDIADVAKMADAADAVPADAETGSNARDA
DARMPAGTCARVAPNPDARARPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIADVVA
DWTGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFLLAGPSGTGK
TETALAVADALFGDERSIVVVNMSEFQERHDVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEK
AHPDVLNLFYQVFDKGSLSDGEGKEVDFANTVIFLTSNLGADIIADIAARGARPDPDAMRAAVRPALSRH
FKPALLARMTEIPYAPLAPDTLADIARLKLERIAARVAAQHATRIVYDDAVVAHVAARCTEVESGARNVD
FILQRHVLPALAQHVLVCAGNAAPMPAIRVAIDAGGRFVVSNDAPADSDARDRSDASDAIDAIDAVDAVD
AVDAPNAPNAPNAPNAPNAPNAPNAR
 
Nucleotide Sequence: 3021 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2064116-2067136 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCTGCTGGTTGACCTGAAACCGTTGATCGAACAGCTCAACCCCTATTGCCGGAACGCGCTCGAAAGCG
CCGTCGGCGCGTGCGTCGCGCGCCGGCACGACGACGTCGCCGTCGAGCACCTGCTCGCGCGGCTGTGCGA
CGAGCCGTCGGCCGACGTCGCGCTGTTGCTGCGCGCGTGCGGCGCGGACGCGGCGCGCCTGCGCCGGCAG
GCCGACGCCGCGCTCGACGCGCGCCCGGCGGGCGACGGCGGCCGCCCCGCGTTCGCGCCGTCGCTGCTCG
CGCTGTTGCAGGACGCGTGGCTGATCGCGTCGCTCGAGCTCGGCGACACGCACATCCGCTCGGCGGCCGT
GCTCGCCGCCGCGGTCGCCCGCGCGGCGCGGCAGCCGTCGCCCGGCGGCGACGACGTGCTGCAGTCGCTG
CGCAAGGACGCGCTCGTCGCGCGCTTTGCGAGCGGCGCGTGCGCGCGATCGATCGAATCGCGCGCGTCCG
GCGCGCTCGACGCCGCGCCGGGCGAGGCGAGCGACACGCGCGACGCATCGAGCGCGATCGCCCGCTACTG
CGAGGACTTCACCGCGAAAGCGCGCGCCGGCGGGATCGATCCGGTCTTCGGTCGCGACGCGGAAATCCGC
CAGATCGTCGACATCCTCGCGCGGCGGCGCAAGAACAATCCGGTGTGCGTCGGCGAGCCGGGCGTGGGCA
AGACGGCCGTCGTCGAAGGGCTCGCGCTGCGGATCGCCGAAGGCGACGTGCCGGCGACGCTGCGCGGCGC
GACGCTGCTCGGCCTCGACCTCGGCATGCTGCAGGCGGGCGCGAGCGTGAAGGGCGAATTCGAGCAGCGG
CTCAAGCGCGTGATCGCCGAGATCCGCGCGTCGCAAACGCCCGTCGTGCTGTTCATCGACGAAGCGCACA
CGCTGATCGGCGCGGGCGGCGCGGCGGGCGCGTCCGACGCGGCGAACCTGCTGAAGCCCGCGCTCGCGCG
CGGCGAGCTGCGCACGATCGCGGCCACCACGTGGAGCGAATACAAGAAGTATTTCGAGAAGGACGCGGCG
CTCGCGCGGCGCTTCCAGCCGGTGAAGCTCGACAGCCCGGACGTCGCGACGTCGGTGATGATCCTGCGCG
GGCTGAAGGAGCGCTATCAGGACGCGCACGGCGTGACGATCCGCGACGACGCGCTCGTGGCCGCGGCCGA
GCTGTCGGCGCGCTACATCACCGGCCGGCAGTTGCCGGACAAGGCGATCGACCTGCTCGACACCGCGTGC
GCGCGCGTGAAGGTGCGCCAGCAGACCAAGCCCGCCGCGCTGGAGGACGCGCAGCGCGCGATCCAGGCGC
TCGAGCGCGAGCGGCGCGCGCTGCGCGACGAATTGGCCGAGCGCTGCGCGCCGGATACGCCGCGCGTCGC
CGACATCGATCGCGAGCTCGCCGCGCTGTCCGCGCGCGCCGGCGCGCTGCGCGACGCGTGGGCGGCGCAG
CGCGAAGCCGCGCAGGCGCTCGTCGACGCACGCCGCGCGTGCCGGGCGGCGGCGGATGCAACGGATGCGG
CTGGAACGACCGGAACGGCCCATGCCGGCGAGCTCGCCGATAGTGCCGACGTTTCCGATATCGCCGATGT
CGCCAAGATGGCCGATGCGGCCGACGCCGTCCCTGCCGATGCCGAAACCGGCTCGAACGCCCGCGACGCC
GACGCACGCATGCCCGCCGGGACGTGCGCGCGCGTCGCCCCGAACCCGGATGCGCGGGCGCGGCCCCCTC
TGCGCGCGCCGCACGCCGACGCGCGCGAGCGCGCGGCTCGTGCGCTCGCCGAAGCGACGCGCCGCTTCGA
GCACGCGCAGCGCGACACGCCGCTCGTGCGAATCGACGTCGATCCGGACGCGATCGCCGACGTCGTGGCC
GACTGGACCGGCATCGCGGCCGGCAAGCTGCGCCGCGATCGCGCGAACGTGATGCTGCGGCTCGCCGATA
CGCTGCGCCGCCGCATCCGCGGCCAGGATCACGCGATCGAACAGATCTCCGAAGCCGTGAAGGCGGGCGC
GGCCGGCGTCCACGATCCGCGCCGCCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGCACCGGCAAG
ACCGAGACCGCGCTCGCGGTCGCCGATGCGCTGTTCGGCGACGAGCGCTCGATCGTCGTCGTCAACATGA
GCGAATTCCAGGAGCGGCACGACGTGAGCCGCCTGATCGGCTCGCCGCCGGGCTACGTCGGCTACGGCGA
GGGCGGGATGCTGACCGAGGCGGTGCGCCAGCGGCCCTATTCGGTCGTGCTGCTAGACGAAGTCGAGAAG
GCGCACCCCGACGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGTTCGCTGTCCGACGGCGAAGGCA
AGGAGGTCGACTTCGCGAACACGGTGATCTTCCTCACGTCGAATCTCGGCGCGGACATCATCGCCGACAT
CGCCGCGCGCGGCGCGCGGCCCGATCCGGACGCGATGCGCGCGGCGGTGCGCCCGGCGCTGTCGCGCCAT
TTCAAGCCGGCGCTGCTCGCGCGGATGACCGAGATTCCGTATGCGCCGCTCGCGCCCGATACGCTCGCCG
ACATCGCGCGGCTGAAGCTCGAGCGCATCGCGGCGCGCGTCGCCGCGCAGCACGCGACGCGCATCGTCTA
CGACGACGCCGTCGTCGCGCACGTCGCCGCGCGCTGCACCGAAGTCGAATCGGGCGCGCGCAACGTCGAT
TTCATCCTGCAGCGCCACGTGCTGCCCGCGCTCGCGCAGCACGTGCTCGTGTGCGCGGGCAACGCGGCGC
CGATGCCTGCGATTCGTGTCGCCATCGACGCCGGCGGCCGCTTCGTCGTCTCGAACGACGCGCCGGCCGA
CTCCGATGCACGGGACCGGAGCGATGCGTCCGATGCGATCGATGCGATCGACGCGGTCGACGCGGTCGAT
GCGGTCGATGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCA
ACGCACGCTGA