SecReT6
Protein ID: 126443380
SecReT6 ID180
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0340
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]307923..309008 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3NG75
KEGG IDbpd:BURPS668_A0340
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-101, Aligned region: 24..325
Protein Sequence: 361 a.a.     [Download]
>gi|126443380|ref|YP_001061346.1| hypothetical protein BURPS668_A0340 [Burkholderia pseudomallei 668]
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFRLGQQPSLAFA
PREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWA
SAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHARLSASPHLVREARNADGLRMTLERYFGVPV
TLEENVFHWIAVDPLEHSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPR
LVEWVRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAHGFARGT
ARDTRGMRGER
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|126442307|ref|NC_009075.1|:307923-309008 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGCGCGCGACATGACGCAGGCGGCCGTTGCCGACACGGCGCTGTCGCCGCAAGCGCTCGCGCGGCTGC
GCGCCGAACCGTGGCGCTATGGGTTCCTCGCGCTGCTGCGCCGCATCGGCGCGGACGCGCGCATCGATCC
GATCGGCAAGGCGAGGCGCCCGCAGGCGGAGCCGTTTCGCCTCGGCCAGCAGCCGAGCCTCGCGTTCGCG
CCGCGCGAGATCGCCAGCGTCGGCGACGCGAACGGGCGGCTCAAGGTGCGGCTGTTCGGGCTCGGGATGC
TGGGGCCGAACGGGCCGCTGCCGATCCACGTGACGGAGATCGCGCGCGATCGCGAGGAGAGCCGGCGCGA
TCCGACGCTCGGCAATTTTCTCGATATCTTCCATCATCGCTATCTGACGCTGCTGTATCGCGCGTGGGCG
TCGGCGCAGGCGGCGGCCGGCCTCGATCGTCCGGATGACGAACGGTTTTCGTTCTACGTCGCGAGCCTCG
CCGGCCAGGATCTCGACGAGGTCGGCGCGCGGCCGCTGCCCGCGCACGCGCGGCTGTCCGCCTCGCCGCA
TCTGGTGCGCGAGGCGCGCAACGCGGACGGCCTGCGAATGACGCTCGAACGTTACTTCGGCGTGCCGGTG
ACGCTGGAGGAAAACGTATTTCACTGGATCGCCGTCGATCCGCTCGAGCACAGCCGGCTCGGCCGGCCCG
GCGACGCATCGACGATGGCCGCGGGCGCGCTGCTCGGCGAGCTGGTGCCGGATCGGCAGCACAAGTTCCG
GCTCGTGTTCGGGCCGCTCGACATCGACGCCTATCTGCGCTTCACGCCGCGGGGCGAGGATCTGCCGCGG
CTCGTCGAATGGGTGCGGGCGTTCGTCGGCTACGAGTTCGAGTGGGAGCTCGAGTTGCGGATCAAGCCGA
ACGGCGCGCCGCCCGCCGTGATGGGCGGCCCGCATCAACTCGGCTGGTCGGGCTGGCTCGGCCGCTCGCC
GTCCGGCGAGCCGGTGACGGGCATGCGTTTCGAACCCGAGCACTATGCGCACGGGTTCGCGCGCGGCACG
GCTCGCGACACGCGCGGCATGCGAGGTGAACGATGA