SecReT6
Protein ID: 126443381
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2120
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2053416..2055323 [-]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDA3NL93
KEGG IDbpd:BURPS668_A2120
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 595..605
Protein Sequence: 635 a.a.     [Download]
>gi|126443381|ref|YP_001063114.1| ImpA-like N-terminal family protein [Burkholderia pseudomallei 668]
MGMSERRPPGGATARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDW
RAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQ
WLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAQRLPVEVVEVVEV
ADEADEADEAETAQTAQTAQTAQTAQTAQTAETAETAETAETAETAEADAHGSTGGPAAEIAIAAAEQAL
IDPAGRAAPSAGTDTNANADAAGQPARLDEAAGRERALADALAQLHCVATAFAQADWADARGFRLRRVAC
WSSVCALPETDTENGRTRIAAPSASIVGAAKNIDGDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARA
GGDGADARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSPRPS
PPERSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCEL
ARDHWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARA
MRLST
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2055323-2053416 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGGGATGAGCGAACGGCGCCCGCCCGGCGGCGCGACGGCGCGCGCGCGCATGCCGATCGATGTCGAAG
CGCTCGCCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGC
GAGGTTCGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGG
CGCGCGGCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATC
TGGCGGGTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCT
CGTCGAACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAA
TGGCTGGTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCGGCATGCGGCGGCGCGTGCTCGGCCG
AACTGGTCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGCATGCGTTCGCGCAGCGATTGCCGGTTGAGGTGGTTGAGGTGGTGGAAGTG
GCTGACGAGGCTGATGAGGCTGATGAGGCTGAGACGGCTCAGACGGCTCAGACGGCTCAGACGGCTCAGA
CGGCTCAGACGGCTCAGACGGCCGAGACGGCTGAGACGGCCGAGACGGCCGAGACGGCCGAGACGGCCGA
GGCCGATGCGCACGGCTCGACGGGAGGGCCGGCCGCGGAAATCGCGATTGCCGCCGCCGAACAGGCTTTG
ATTGATCCGGCCGGTCGAGCCGCGCCGAGCGCCGGCACGGATACGAACGCGAACGCAGACGCCGCCGGGC
AACCGGCGCGGCTCGACGAAGCGGCCGGCCGCGAACGCGCGCTCGCCGATGCGCTCGCGCAACTGCATTG
CGTCGCGACGGCGTTCGCGCAAGCGGACTGGGCCGACGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGC
TGGTCGAGCGTGTGCGCGCTGCCGGAAACGGACACGGAGAACGGAAGAACGCGGATCGCCGCGCCGAGCG
CTTCGATCGTCGGCGCGGCGAAGAACATCGACGGGGATGGCGAGCCCGTGGCGGCGGTGCGCTTCGCCGA
AGCGCATGCGCAGGCGTTCCCGCTCTGGCTGGATTTGCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCG
GGGGGCGACGGCGCCGATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTGCACTGCTTGCGCGGCTGCCGG
GCCTCGACGCGCTGACGTTCGCGGACGGCACGCCGTTCGCCGACGACGCGACGCGCGCATGGCTCGGCGA
GCTTGGCGCGCCTGTTGTGGCGGCGGATGCGGTGTCGCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCG
CCGCCTGAGCGATCGTCGCCGATGGCGGGCGAACCGGCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGCG
CCGACGATGCAGTGGACCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCTCGATCTCGCGCTCCACGCGAT
TCAGCATGCGATCGATCGTGCGACGAGCGCCGAACAGCGGTTGAGAGCGCGCGTGCGGTTGTGCGAGCTT
GCGCGCGACCATTGGCCGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCGTGATCGAACCGATTCGGCGGC
ACGACTTGCTCGCATGGAATCCGGAGCTGGCGCTCGACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCG
GCGCGATCGCGAATCGGCGCACGCGAGGACGGTGCTTGACGAGATCGCGAGCGTCGACGCGGCGCGGGCC
ATGCGTTTGTCGACGTGA