SecReT6
Protein ID: 126443398
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2955
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2807434..2808900 [-]
Producthypothetical protein
NoteTssG
UniProt IDA3NNM5
KEGG IDbpd:BURPS668_A2955
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-129, Aligned region: 85..435
Protein Sequence: 488 a.a.     [Download]
>gi|126443398|ref|YP_001063946.1| hypothetical protein BURPS668_A2955 [Burkholderia pseudomallei 668]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANAEANAEPDAMPNALRGAAADVAPSAAPSATPNATPSATS
QAAAARRDAWWRRLRAAPHGYDLLHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVR
DDGPRPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSL
DRPARARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDLPPDSPPDSRSDSPSDARLDPHPDS
PRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRPTQPL
GGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGVHARQLAQWVREYVGIEFDWDVQLELARDEVPTLA
LGSRHGLGRTAWLGERLDPGPARDLVLGYDERMRASRARSGAADQAAAAGALIANLPEREAPCPISAE
 
Nucleotide Sequence: 1467 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2808900-2807434 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAATGCGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCGCTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCAAATGCAACGCCGAGCGCGACGTCG
CAGGCCGCCGCCGCGCGCCGCGACGCGTGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGC
TTCATGCGCTGCGTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCG
CGACGAGCCGGTGCGTTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGT
GACGACGGCCCGCGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGT
CGCATCTGACCGAGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGA
CCTGTTTCATCATCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTC
GATCGGCCGGCGCGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTG
CCGATTCACCGCGCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTTACC
ACCTGATTCACCGCCTGATTCGCGGTCCGATTCCCCGTCCGATGCGCGCCTCGATCCGCATCCCGACTCG
CCGCGCGGTGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGGTGCGGCACACGC
GCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTACTTCGGTGTGCGGGTACGCATCGTCGAGCACGT
GCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCGACGCAGCCGCTC
GGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGCTCGGCCCGCTGA
CGCTCGACGAATACCGGCGGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCAATGGGTGCGCGA
ATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGACGAAGTGCCGACGCTCGCG
CTCGGCAGCCGTCACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGACCCCGGCCCCGCGCGCG
ACCTCGTGCTCGGCTACGACGAGCGCATGCGCGCTTCGCGCGCCCGATCGGGCGCGGCCGATCAGGCGGC
CGCCGCCGGTGCATTGATCGCCAACCTGCCTGAACGGGAAGCGCCATGTCCGATATCGGCCGAGTGA