SecReT6
Protein ID: 126443462
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0154
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]134811..135500 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3NFN9
KEGG IDbpd:BURPS668_A0154
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-31, Aligned region: 8..205
Protein Sequence: 229 a.a.     [Download]
>gi|126443462|ref|YP_001061160.1| hypothetical protein BURPS668_A0154 [Burkholderia pseudomallei 668]
MSIEMPAQPLRMLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGYRGGIANELSLAQCV
FLDEITMRNLSPEQKEEWLRELLQFRFHSTRDGLSKVRARVDRLCRGHSANAALLEMYSLFHEFGLLGDK
QGHALADARVSEARPTPGKKAVETAEIWKDGGAANEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEV
EQMEVTSGDEAAIHPASGD
 
Nucleotide Sequence: 690 bp     [Download]
>gi|126442307|ref|NC_009075.1|:134811-135500 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGTCGATTGAAATGCCCGCGCAGCCGCTGCGCATGTTATTGCAGGACACGATGCTCCATGTCGCGCTAT
TGACGCAAGGCGCGCGCATATCGCGCGTGCATGACTGGCGCGCGCGCTGCATCGCGCTCGTCAGGCAATT
CGAGCAGGCGCTGCAGGACGGCGGCTACCGCGGCGGTATTGCCAATGAATTGAGCCTCGCGCAATGCGTT
TTTCTGGACGAGATCACGATGCGCAATCTGTCGCCCGAGCAAAAGGAAGAATGGTTGCGTGAGCTCCTTC
AGTTCCGCTTCCACTCGACTCGGGATGGGTTGAGCAAAGTGCGTGCGCGTGTCGATCGCCTTTGCCGCGG
GCATTCGGCGAATGCCGCATTGCTGGAAATGTATTCGTTGTTCCATGAATTCGGTCTCCTGGGAGACAAG
CAAGGGCACGCGTTAGCCGACGCGCGGGTGTCGGAGGCAAGGCCGACGCCCGGAAAGAAAGCCGTGGAAA
CGGCGGAGATTTGGAAGGACGGGGGGGCCGCCAATGAAGCGGCGCACGGACGCTCTTGGCGAATCGTCGG
CGGCCTGCTGGCGTTTGCGGCGCTCATGACGATGTGGCTCGTTATCGACACACGTCTGAGCCATGAAGTG
GAACAGATGGAAGTCACGTCCGGAGATGAAGCAGCGATTCATCCGGCATCGGGGGATTGA