SecReT6
Protein ID: 126443497
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2953
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2802588..2804792 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3NNM3
KEGG IDbpd:BURPS668_A2953
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-85, Aligned region: 23..325
Phage_GPD [PF05954], Evalue: 2.90E-85, Aligned region: 581..641
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 364..456
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 510..525
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 530..547
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 581..603
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 646..664
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 715..727
Protein Sequence: 734 a.a.     [Download]
>gi|126443497|ref|YP_001063944.1| Rhs element Vgr protein [Burkholderia pseudomallei 668]
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGI
VARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDY
CVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGCEHIPFIARDRTAIADEEHIDS
WLPAQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAE
HERALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLP
YRSPRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKG
AEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETH
GVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHA
EEIGSRTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTV
ESSASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2804792-2802588 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
GTGACCCGCGTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCACCGGCTCTACGGCGAGG
AAGCGCTCGGGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGA
ACTGCTCGGCAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATC
GTCGCGCGCGCCGCGCTGGTCGGGCGGCGCGCGGAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGT
GGCTGTGGCTCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAGATCGTGCA
GGACGTGCTCGGCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTAC
TGCGTGCAGTACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACT
ACTTCAAGCACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCC
GGGCTGCGAGCACATTCCGTTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGC
TGGCTGCCCGCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCG
CGGATCTGTCCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCC
CGGCGGCTATCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAGGCGGAG
CACGAACGCGCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACT
GCCCGCGCGCCGACCAGAACCGCGAATACCTGATCGTGCGCTGCCAGTATCGGTTTCAGGAGAACGCGTA
CGCGACCGATAGCGGCAACGAGGCGGTCGTGCACGAATCGCAGACACTCGTGCAGCCTTCGAGCCTGCCG
TATCGCTCGCCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGA
AGGGCGAGGAAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCA
GAGCGACCAGAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTG
CAGATCCCGCGCATCGGCGATGAGGTGGTGGTCGATTTCCTGAACGGCGACCCCGATCAGCCGATCGTGA
CGGGGCGCGTGTACAACGGCGAGAAGATGCCGCCATGGGGGCTGCCCGGCAGCGCGACGCAAAGCGGGCT
GCTGTCGCGCTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGC
GCGGAGCAGCTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAAACCGAGCAGGACCACACGCTGTCGG
TGGGCCACGATCACTCGCATTCGGTCGGCAACAACGAGATGATGAGCGTCGCGAACGACCGGCAAAGGAG
CGTCGGGCAGAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCAT
GGCGTCGCGGGAAACCGCACGCGGCAGGTCGGACAGAACGAGGCCGTGACGATCGGCGCGAATCGCGAGG
CGACGATCGGCGGCAATCACGTGGAGACGGTCGCGAAAGACAAGACCGAAACGATCGGGCAGGGCAAGAC
GCTGAATGTCACTCAGCATTATCAGACGACTTCGAAGAGCATGAAGACCGCTGTCGCCGAACATCACGCC
GAGGAGATCGGCTCGCGAACGTCGACGATCGAGAAAGCGCACGAGCTCAACGTTGGCGGTTCTCAATCGG
TGAACGTTGGCGCGAGCCACACGATGAGCGTGAAGAACAACGTACATGTCGGCGCGGGCGATCAGATCTC
GCTCGTTTGCGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATCGCGATCAACGGCGTCACGGTG
GAATCGAGCGCCAGCGGAAGCCATAGCGTGCGCGGCAAGACAGTGACGTCGTCGGCGACGGGCGAGCACA
CGGTGGAAGGCACGATACTGAAACTGAACCCCTGA