SecReT6
Protein ID: 126443591
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2966
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2822609..2823925 [-]
Producthypothetical protein
NoteTssL
UniProt IDA3NNN6
KEGG IDbpd:BURPS668_A2966
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 49..253
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 335..363
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 376..417
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 250..259
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 318..416
Protein Sequence: 438 a.a.     [Download]
>gi|126443591|ref|YP_001063957.1| hypothetical protein BURPS668_A2966 [Burkholderia pseudomallei 668]
MNTSSDSFSAGSGGFVPPNPGGAHPAAAPAAGAAAFQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTVH
HPNPAWLREHLVVEIRQFEERAQQAGVASEAIIGARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNET
WGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGRAQLDAVRRQLAQTIRSVRGEFDPA
LSPHWRDVVTRDVTRRFTVPLWVCVALALLVGFGVFAGLRIALAGHSDRLFASIDALHVPKLQPAPPAPH
PAPAPRVAKFLEPEIAAGLVSVRDEADRSVIVLRGDGLFGSGSTSVIDRYMPVLTRVADALNQVQGNVRV
SGYTDDTPVHTARFASNWDLSRERAQAVRSLIAARLDRPERITAEGRGTLDPVAPNDSPANRARNRRVEI
TLMLAPGSDAARATKEAP
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2823925-2822609 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAACACTTCTTCCGATTCGTTCTCGGCCGGCTCGGGCGGATTCGTGCCGCCGAATCCGGGCGGCGCGC
ACCCGGCCGCCGCGCCGGCGGCGGGTGCGGCTGCGTTTCAGCCGAGGCCGGGCCGCTGGGCGGCGAGCGG
CACGAATCCGCTCGTCGCGGCCGCGAACCCGCTGCTGAACCTCGTGCCGCAGATCCGTTCGACCGTCCAT
CATCCGAATCCCGCGTGGCTGCGCGAGCATCTCGTCGTCGAGATCCGCCAGTTCGAGGAGCGCGCGCAGC
AGGCGGGCGTCGCCTCCGAGGCGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCCGC
CGCGCTGACGCCGTGGGGCGGCAGCGTATGGTCGTCGCATAGCCTGCTCGTGTCGTTCCACAACGAGACG
TGGGGCGGCGAGAAGTTCTTCCATCTGCTTGAGCGGCTGTCGCAGCAGCCGCGCCAGCATCTCGACCTGC
TCGAGCTGCTGTACTTCTGCCTCGCGCTCGGCTTCGAGGGGCGCTATCGCGTGCTCGACAACGGCCGCGC
GCAGCTCGACGCGGTGCGCCGCCAGCTCGCGCAGACGATCCGCTCGGTGCGCGGCGAATTCGATCCGGCG
CTCTCGCCGCATTGGCGCGACGTCGTCACGCGCGACGTCACGCGGCGCTTCACGGTGCCGCTGTGGGTGT
GCGTCGCGCTCGCGCTGCTCGTGGGCTTCGGCGTGTTCGCGGGGCTGCGCATCGCGCTCGCCGGCCATTC
GGATCGGCTGTTCGCGTCGATCGACGCGCTGCACGTGCCGAAGCTGCAGCCGGCGCCGCCCGCGCCGCAT
CCGGCGCCCGCGCCGCGCGTCGCGAAGTTCCTCGAGCCGGAGATCGCCGCGGGGCTCGTGAGCGTGCGCG
ACGAGGCCGACCGCAGCGTGATCGTGCTGCGCGGCGACGGCCTGTTCGGCTCCGGCTCGACGTCGGTGAT
CGATCGCTACATGCCGGTGCTCACGCGCGTGGCCGACGCGCTGAACCAGGTGCAGGGCAACGTGCGCGTG
AGCGGCTACACCGACGACACGCCGGTGCACACCGCGCGCTTCGCATCGAACTGGGATTTGTCGCGCGAGC
GCGCGCAGGCGGTCCGCAGCCTGATCGCCGCGCGGCTCGACCGCCCCGAGCGGATCACCGCCGAAGGGCG
CGGCACGCTCGATCCGGTCGCGCCGAACGATTCGCCCGCGAACCGCGCGCGCAACCGGCGCGTCGAGATC
ACGCTGATGCTCGCGCCCGGCAGCGACGCCGCGCGCGCGACGAAGGAGGCGCCCTGA