SecReT6
Protein ID: 126443630
SecReT6 ID179
T6SS typei3
Gene symbolsciM
Locus tagBURPS668_A0159
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]139840..140322 [+]
ProductSciM protein
NoteTssD
UniProt IDA3NFP4
KEGG IDbpd:BURPS668_A0159
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.80E-41, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|126443630|ref|YP_001061165.1| SciM protein [Burkholderia pseudomallei 668]
MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSGGGAGKATIDDLQFEHYIDRASPNLV
QYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDVLVTQVSPAGVAQDESRPRELVRLSFSRLKQEYVVQN
AQGGSGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|126442307|ref|NC_009075.1|:139840-140322 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGTCGCACGACATTTTCCTCAAGATCAACGGTATCGATGGCGAGGCGGAAGACGCAACCCACAAGGGCG
AAATCGAGGTCTTGAGCTGGTCGTGGAACGTCAGTCAGCAATCGAACATGCACCTGGGTTCGGGGGGCGG
CGCGGGCAAGGCGACGATCGATGATCTGCAGTTCGAACATTACATCGATCGCGCGAGCCCGAATCTCGTT
CAATACTGCTTGCTCGGCAAGCATATCGACGAAGCCCGGCTCGTGGTGCGTAAGGCGGGCGGCAGCCCGC
TCGAATACATCAAGCTCACGATGAGCGATGTGCTCGTTACGCAGGTGAGCCCGGCAGGCGTGGCTCAGGA
CGAATCGCGCCCGCGTGAGCTCGTTCGGCTGTCGTTTTCGCGCCTGAAGCAAGAGTATGTCGTCCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCAATCACCGCGACTTTCGACATCAAGAAGAACGCGGCGTAA