SecReT6
Protein ID: 126443847
SecReT6 ID181
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0802
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]776643..777236 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDA3NHI0
KEGG IDbpd:BURPS668_A0802
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-12, Aligned region: 19..154
Protein Sequence: 197 a.a.     [Download]
>gi|126443847|ref|YP_001061801.1| putative lipoprotein [Burkholderia pseudomallei 668]
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADW
LPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEG
RGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEPPPERKTKTTYGTRRSRQ
 
Nucleotide Sequence: 594 bp     [Download]
>gi|126442307|ref|NC_009075.1|:776643-777236 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
GTGCGTCACAAGATGGGCCCCTTCAAATCGATCGCGGCGGCGCTCGCGCTCGGCGTGCTCGCCGGCTGCT
CGGCCTTCTCGTCGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCGTCGGCGGCGCCCGGCT
GAACGTCGCGCCGACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGTGACCGCGGCCGACTGG
CTGCCGACGCAGGGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACT
CGCGGCACGTGATCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGCGAGCTCTG
GCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCGCGTGCGCGTCGAGGGC
CGCGGCTTGATTCACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCCG
TGCCCGTCGGCGGCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGCCCGAGCGCAAGACGAA
AACCACCTATGGGACAAGGAGAAGCAGGCAATGA