SecReT6
Protein ID: 126443853
SecReT6 ID180
T6SS typei3
Gene symbolsciN
Locus tagBURPS668_A0330
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]296931..297434 [-]
ProductSciN protein
NoteTssJ
UniProt IDA3NG65
KEGG IDbpd:BURPS668_A0330
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-40, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|126443853|ref|YP_001061336.1| SciN protein [Burkholderia pseudomallei 668]
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYELKTDGAFNAAD
FFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGALGVVAAYRDLPNSVWRAAYPLPPARDAA
WYRFSSPKLKLTIELDTHAIRITEPGK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c297434-296931 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCATCCGACCACCCCCGTTGCCGCCGTCGCGCTCGCGCTCGCGTGCGCCGCGTGCGCGAGCGGCGCGG
CCAAGCAGAAGGAGCCGCTGCGGCTCGAGCTCGCCGTGCGCGCCGCGCCCACGGTCAATCCGGACGATCG
GAGCCGGCCGGCTCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCATTCAACGCCGCCGAT
TTCTTCACGCTGCAGGGCCCGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGCGTTTTCAAC
TGCGCCCCGGCGAGCGCCGCGTGATCCGGCGCGACGCCGATCCGGCGGCGGGCGCGCTCGGCGTGGTCGC
CGCGTACCGCGATCTGCCGAACTCGGTGTGGCGCGCGGCATATCCGCTGCCGCCCGCGCGGGACGCCGCA
TGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGAGCTCGACACGCACGCGATCAGGATCACCG
AACCCGGAAAATGA