SecReT6
Protein ID: 126443940
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0167
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]151286..151561 [+]
ProductRhs family protein
NotePAAR
UniProt IDA3NFQ2
KEGG IDbpd:BURPS668_A0167
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.20E-14, Aligned region: 5..23
PAAR_motif [PF05488], Evalue: 2.20E-14, Aligned region: 9..83
Protein Sequence: 91 a.a.     [Download]
>gi|126443940|ref|YP_001061173.1| Rhs family protein [Burkholderia pseudomallei 668]
MNMTIPAARVGDAIGHGGVLVTGSGDVFMNGIPAGFVAGSVAVCALHASAQAVVAASGTVFINRLPAAFV
GGVTSCGAPIVSGSPDVMIGS
 
Nucleotide Sequence: 276 bp     [Download]
>gi|126442307|ref|NC_009075.1|:151286-151561 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
TTGAACATGACAATCCCGGCAGCAAGAGTGGGAGATGCGATCGGACATGGCGGCGTTCTCGTCACCGGCT
CAGGTGACGTATTCATGAACGGCATTCCCGCGGGATTCGTCGCCGGCAGCGTCGCCGTGTGCGCGCTGCA
TGCGTCCGCGCAGGCGGTGGTCGCCGCATCGGGAACGGTATTCATCAATCGCCTCCCGGCTGCGTTCGTC
GGTGGCGTGACGTCGTGCGGCGCGCCGATCGTTTCAGGCTCGCCCGACGTCATGATCGGCTCATAA