SecReT6
Protein ID: 126443954
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2125
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2060377..2060886 [+]
Producthcp protein
NoteTssD
UniProt IDA3NL98
KEGG IDbpd:BURPS668_A2125
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|126443954|ref|YP_001063119.1| hcp protein [Burkholderia pseudomallei 668]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFTYSGYSLEHAESGIAGAANWTNG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2060377-2060886 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAAATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCCGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCACGTATTCGGGATACTCGTTGGAACACGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA