SecReT6
Protein ID: 126444048
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0155
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]135503..137179 [+]
ProductOmpA family protein
NoteTagL
UniProt IDA3NFP0, A3NFP0
KEGG IDbpd:BURPS668_A0155
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.00E-18, Aligned region: 441..537
DUF218 [PF02698], Evalue: 0.0006, Aligned region: 446..517
Protein Sequence: 558 a.a.     [Download]
>gi|126444048|ref|YP_001061161.1| OmpA family protein [Burkholderia pseudomallei 668]
MSRQIRFWLVWGAIPFVVLASLCLPLRMQPDWSHVLTIVLIIAAIVLAIEIFEHSRETAQDRTAEAEIDD
HELAVIIVAGPHASSLFNSSGDDTAFRREAGALWLRADSVEQLRDTMMRVKASRGRFPDAAVVPLVSESD
DESDMRQAFAKWRTELREALCYPDAAYVLPCYLAVYTCLGFKGADGARPKWTGDAIEIGTRQMNAASKVG
ELLASIRQQLLRPSPTGSSAQCALGLGVFDWLDATALLSSMTMLANTPPFMLKGLTLADVGRRPIRPGAW
TRWLTVRTGLHIRQTKSSMAPLPVPRVAKHAESGIREGWSSARHLVSTRASFVPALVFSTVSTLGIAVAV
SGWMNSRMIQRVSNDIADYRSGADEWIGRKRFAQARLEHDRTAIVQTLLDGVPTGFGWGLYRGQELLVKL
DTVLDSPRAASIAMQLDTVSLFAAGKATFSPGAAQRELQHALRMILANPEQRVLIVGHADSSGSDAANFQ
LSEARARAIRDWFVDQGVLKTRFIVQGAGDTHPIADNDSPSGRAQNRRVEVLLIPDVSSDRKASGTEL
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|126442307|ref|NC_009075.1|:135503-137179 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGTCGCGTCAGATTCGATTTTGGCTCGTATGGGGCGCCATACCCTTCGTGGTGCTCGCGAGCCTTTGCC
TGCCGTTGCGCATGCAGCCGGATTGGTCTCATGTGCTGACCATCGTTTTGATCATTGCCGCCATCGTGCT
GGCGATCGAAATATTCGAACACTCTCGCGAGACAGCGCAAGACCGAACGGCCGAAGCCGAAATCGACGAT
CACGAGCTGGCGGTGATCATCGTCGCGGGCCCTCACGCATCGTCGCTTTTCAATAGCAGCGGGGACGATA
CGGCGTTTCGGCGCGAAGCCGGCGCGTTATGGCTGCGCGCCGACAGCGTCGAGCAATTGCGAGACACGAT
GATGCGCGTCAAGGCGTCGCGCGGACGGTTCCCGGACGCCGCCGTGGTGCCGCTCGTATCGGAAAGCGAT
GACGAAAGCGACATGAGGCAGGCGTTCGCGAAGTGGCGAACCGAACTCCGCGAAGCGCTTTGCTATCCCG
ATGCGGCCTATGTCCTGCCTTGCTATCTCGCCGTCTACACGTGTCTTGGATTCAAGGGAGCCGACGGCGC
GCGTCCGAAGTGGACGGGCGATGCAATAGAAATCGGCACGAGGCAGATGAATGCCGCATCGAAAGTGGGC
GAGCTGCTCGCATCGATTCGACAACAACTGCTTCGGCCGTCGCCCACCGGTTCGTCGGCGCAGTGCGCGC
TGGGGCTCGGCGTGTTCGATTGGCTCGACGCCACGGCGCTGCTGTCGTCGATGACCATGCTGGCGAATAC
CCCGCCATTCATGCTGAAAGGGCTGACGCTCGCGGATGTCGGCAGACGGCCGATACGTCCGGGAGCGTGG
ACGCGCTGGCTCACTGTTCGGACCGGTCTCCATATTCGCCAGACCAAATCGTCGATGGCGCCGCTTCCCG
TGCCGCGCGTGGCGAAGCATGCCGAAAGCGGCATTCGGGAAGGATGGAGCAGCGCGCGCCATCTCGTTTC
CACTCGTGCGAGCTTCGTGCCGGCGCTCGTGTTCTCCACTGTTTCGACGCTGGGCATCGCCGTGGCGGTC
TCGGGCTGGATGAACAGCCGCATGATCCAGCGGGTGTCGAACGATATCGCGGATTATCGGAGCGGAGCCG
ACGAGTGGATCGGGAGGAAGCGCTTTGCGCAGGCCCGCCTCGAACACGATCGCACGGCGATCGTGCAGAC
GCTGCTCGATGGCGTACCGACCGGTTTCGGCTGGGGACTCTACCGGGGGCAGGAGTTGCTGGTCAAGCTC
GATACGGTGCTGGATTCGCCGCGCGCGGCGTCGATCGCGATGCAGCTCGACACGGTATCGCTGTTCGCCG
CGGGCAAGGCTACATTTTCTCCGGGCGCCGCGCAGCGTGAGTTGCAACATGCATTGCGGATGATTCTCGC
CAATCCGGAACAACGTGTGCTGATCGTCGGTCATGCAGACAGCTCCGGCTCGGATGCGGCCAATTTTCAG
TTATCCGAAGCGCGTGCGCGCGCGATTCGTGACTGGTTCGTCGATCAAGGCGTGCTGAAGACGCGCTTCA
TCGTGCAGGGAGCCGGCGATACGCATCCGATCGCCGATAACGACAGCCCTTCGGGACGTGCGCAGAATCG
CCGTGTCGAGGTCTTGCTGATTCCGGACGTTTCTTCCGACAGGAAGGCGAGCGGTACGGAACTATAG