SecReT6
Protein ID: 126444080
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2967
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2823941..2825344 [-]
Producthypothetical protein
NoteTssK
UniProt IDA3NNN7
KEGG IDbpd:BURPS668_A2967
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-159, Aligned region: 30..466
Protein Sequence: 467 a.a.     [Download]
>gi|126444080|ref|YP_001063958.1| hypothetical protein BURPS668_A2967 [Burkholderia pseudomallei 668]
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGK
VALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGAGGNGEGHGGDGNA
HAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYI
PPRLVAQRDPVLLRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAA
HPETLFCDWLKLACDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGN
GMKVATIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2825344-2823941 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAACGAGCCGGTATTGTCCGCGACCCCCGCTGCGGCGTTGCGCCAGCGCGTGATCTGGACCGAGGGCA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAGCGGCACTGGGAGCGCTACGTCGGCATGCGCTGCCT
GCCGCTGCAAGGCTTCTACTGGGGCTACGACGAGTTGCAGATCGATCGCGAGCTGCTCGCGCTCGGCAAG
GTCGCGTTGCTCGCCGCGACCGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCGGACGACC
GGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGATCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCG
CGGCGGCGCGCAGGAGGTGTCGTTCGGCGCGGGCGGCAACGGCGAAGGCCACGGCGGCGACGGCAACGCG
CACGCGGGCTTCGCGCGCTACGTCGTGCGCGAATACGAAGTCGCCGACGCGAACGAGGTCGCGCTCGGCC
CCGCGCTATTGCAGACCGGCCGCCTGAACGTGCGCCTGATGCTCGAATCCGAATTGACGGGCGACTGGCA
GGCGCTCGGCGTCGCGCGCGTCGTCGAGCGGCGCACCGATGGGCGGCTGCTCGTCGACGACGGCTACATT
CCGCCGCGGCTCGTCGCGCAGCGCGATCCGGTGCTGCTGCGCCACACGCGCGAGCTGCACGGGCTGCTCA
CGCAACGCAGCGAGGCGCTCGGCGAGCGCCTGTCGGAGCCGGGGCGCGGCGGCGTGTCCGAAGTCGCCGA
TTTCCTGCTGCTGCAACTCGTCAACCGCTATCTGGCGCTCACGTGGCACGCGCAGCAGGATGTCGCCGCG
CACCCGGAGACGCTGTTCTGCGATTGGCTGAAGCTCGCGTGCGACCTGAGCACGTTCACCGCGGCCGGCC
GCCGGCCGCAGTCGCTCGCGGTCTACCGGCACGACGATCTGCGCGCGAGCTTCGGCGAGCTGATGGCCGA
GCTGCGCCGCTCATTGTCGACGGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGACGTGGGCAAC
GGCATGAAGGTCGCGACGATCGCCGATCCGGCGCTGCGCGACACCGCGGGCTTCGTGCTCGCCGTGCGCG
CCGACGTGCCGGCCGACAGCCTGCGCGCGCGCTTTCCCGCGCAGGCGAAGCTCGGGCCCGTCGAGCGCAT
TCGCGATCTCGTGCAGTTGCAACTGCCGGGCATCGCGATGCGGCAGTTGCCCGTCGCGCCGCGGCAGATT
CCGTATCACGCGGGCCACACGTACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAACAGCTCGAACGCT
CGGGCGGCCTCGCATTTCATTTCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCGCGG
GTGA