SecReT6
Protein ID: 126444137
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0174
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]161915..162721 [-]
ProductImpE/SciE family protein
NoteTagJ
UniProt IDA3NFQ9
KEGG IDbpd:BURPS668_A0174
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.70E-44, Aligned region: 139..259
Protein Sequence: 268 a.a.     [Download]
>gi|126444137|ref|YP_001061180.1| ImpE/SciE family protein [Burkholderia pseudomallei 668]
MLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQTWAGLEPQGEARAQLHR
GLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGS
FAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALMLDATVLRGYAPTRYSG
SENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDDAAS
 
Nucleotide Sequence: 807 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c162721-161915 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCTGCGCGACGCGCTGCGCGCCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAGGCGGTCAGAA
AGCGGCCATCCGACACGCGGGAACGCTGGCTACTGTTTCAGTTGCTTTGCATCGACGGCGCGTGGGAGCG
CGCGCTCAAACAGCTGCAAACCTGGGCCGGGCTCGAGCCGCAGGGCGAGGCGCGCGCGCAACTGCATCGC
GGCCTGATCCGATGCGAAATGTTCCGGGCCGACGTGTTTGCCGGCAAGCGAACGCCGGGGTTCATCGACG
CGCAGCCCGCCTGGGTCGACACGCTCCTCCAAGCCAATGCGAAGCTCGGCGCCGGCGACGTCGCGGCGGC
GGACACGCTGCGCGAGGCCGCGTTCCACTGCGCCCCTGTCACCCGCGGGGAAAGCGCCGAAATGGGAAGC
TTCGCATGGCTTACCGACAGCGACACCCGCCTCGGTCCGATCTTCGAAATAGCGGTTGCAGGCGGCTATC
GATGGATTCCGTTCGAACAACTGAAGTCCATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTG
GCGGCCGGTCACGGCACTCATGCTCGATGCCACGGTTCTCCGCGGCTATGCACCCACCCGCTATTCGGGA
TCGGAGAACGGCGCGACCGCGATCCGCTTGGCCAGCGAGACGACCTGGCGCGACATCGGCACCACCAATG
TCGTGGCGCTCGGACAACGAACATGGACCACCGATCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATG
CCGCTTCACGGGCGAAAGCGACGATGCGGCATCCTGA