SecReT6
Protein ID: 126444172
SecReT6 ID179
T6SS typei3
Gene symbolsciN
Locus tagBURPS668_A0160
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]140360..140992 [+]
ProductSciN protein
NoteTssJ
UniProt IDA3NFP5
KEGG IDbpd:BURPS668_A0160
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-36, Aligned region: 56..204
Protein Sequence: 210 a.a.     [Download]
>gi|126444172|ref|YP_001061166.1| SciN protein [Burkholderia pseudomallei 668]
MGRGPEAAVRGARIASAANSGFSRGDRIIQMAFPFFFRREAARQTAVKRVVAAMVCASLAACASLPARKE
TADLIVKIKVSEGANPDEHQRPAPVMVRLYELKSAGAFENADFFTLQSDSRKVLGDDAIATDEFVMRPGD
TRDIHRRADSAGTSIGVLVGYRELGKSVWRAVHKLRPAPEDAWYRAFTPRTKIKLNVDVGQQTVTITELE
 
Nucleotide Sequence: 633 bp     [Download]
>gi|126442307|ref|NC_009075.1|:140360-140992 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
GTGGGGCGAGGCCCGGAGGCTGCTGTTCGCGGCGCTCGTATCGCGAGCGCCGCGAACAGCGGCTTTTCCC
GGGGCGACAGGATCATCCAGATGGCTTTCCCATTTTTCTTTCGCCGCGAAGCGGCCAGGCAAACCGCCGT
CAAGCGCGTTGTGGCGGCAATGGTATGCGCATCGCTCGCGGCTTGCGCAAGCTTGCCGGCACGCAAGGAA
ACAGCCGATCTGATCGTGAAGATCAAGGTGAGCGAAGGCGCCAATCCGGATGAGCATCAGCGCCCGGCGC
CCGTGATGGTGCGGCTGTACGAGCTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTACA
GAGCGACAGCCGCAAGGTGTTGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGCCCGGGCGAC
ACCCGGGATATTCATCGGCGTGCCGATTCCGCGGGGACGTCGATCGGCGTGCTGGTCGGTTATCGAGAGC
TCGGCAAATCGGTGTGGCGGGCGGTCCATAAGCTGCGGCCGGCTCCGGAGGATGCATGGTACCGGGCATT
CACGCCAAGGACGAAAATCAAGTTGAACGTCGATGTCGGGCAGCAGACGGTGACGATTACAGAATTGGAA
TGA