SecReT6
Protein ID: 126444399
SecReT6 ID181
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0803
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]777233..778594 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3NHI1
KEGG IDbpd:BURPS668_A0803
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-120, Aligned region: 21..448
Protein Sequence: 453 a.a.     [Download]
>gi|126444399|ref|YP_001061802.1| hypothetical protein BURPS668_A0803 [Burkholderia pseudomallei 668]
MSSLPVGPVAWSDGMLIETQHFQQLERHLAHQASLRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGV
FQDGTAFSLPSDDPLPPPLETELAQAGDIACLALQAARTGGPEMAFGDVELASRYRAVSTEVPDLAVGLD
APGTPRRLTIETGQLVTRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLID
ELQSTLRVRLASTSAQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLS
VLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIETPVLPLRFEDRGDQVHICIVDKQWNLKKL
IFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFW
KQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|126442307|ref|NC_009075.1|:777233-778594 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAGTAGTCTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGC
AGCTCGAGCGGCATCTCGCGCATCAGGCCTCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTT
CACGCTGCTCGATCTCGACCAGGACGGCCTGGGGCTCGGCCGGCTCGGGCTGCGCCACGCGCGCGGCGTG
TTCCAGGACGGCACCGCGTTCTCGCTGCCGTCGGACGATCCGCTGCCGCCGCCGCTGGAAACCGAGCTCG
CGCAGGCGGGCGACATCGCGTGCCTCGCGCTGCAAGCCGCGCGCACGGGCGGCCCGGAGATGGCGTTCGG
CGACGTCGAGCTGGCGTCGCGCTATCGCGCGGTGTCGACCGAGGTGCCGGATCTCGCGGTCGGGCTCGAC
GCGCCCGGCACGCCGCGGCGCCTGACGATCGAGACGGGCCAGCTCGTCACGCGCCTGTGCTGGAAGTCGC
AGCTGCGCTCGGACGAGGTCGCGCTGCCGATCGCGCGCGTGGCGGGGCGCAACGCGAGCCGCACGGTGTC
GCTGGATCCGCGCTTCATTCCGCCGCTGCTCGACACGCGCGCGCACCTGGTGCTGCGCTCGCTGATCGAC
GAGCTGCAGAGCACGCTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAGCGCGTGCTGTCGACGGGCGGGG
GCGTGGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCGCCGAGTACCGGATGCGCTTGGCGAACCT
CGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGAACTGGTCGGCCTGCTCGGGCGGCTGAGC
GTGCTGCCGGGCGTCGACGAGGAACTGGCCGACCGCGAGCTCGGCTACGACCACGACGATCTGCAGACGA
GCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAGACACCGGTGCTGCCGCT
GCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGTGGAACCTGAAGAAACTG
ATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCCGCAGCAGACGAAGCTGG
GCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGGCTGAACGCGCTGCCCAA
TCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAATCGACCGATCCGTTCTGG
AAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCCCGATCTTCGCTTCGAAG
CCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA