SecReT6
Protein ID: 126444432
SecReT6 ID181
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0794
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]763598..764587 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3NHH2
KEGG IDbpd:BURPS668_A0794
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-58, Aligned region: 13..312
Protein Sequence: 329 a.a.     [Download]
>gi|126444432|ref|YP_001061793.1| hypothetical protein BURPS668_A0794 [Burkholderia pseudomallei 668]
MTPLERVSRALTPRRTFFELMRRVEALQRRHDGRSARKRRMPKWLRIEQPAQMHFASTEVERVQVTLARF
VEDDDHPQVTVAQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVNVACGDLAWLHYSAWSSMHPV
LGYERARNPFVERVTALADACRAQQDDGEPYGRHALACRRAFPGIYCAPRRSLADLQRLLRAYFGVALQV
VPRHGRWVPVPAAASHARRLGGWRLGARIWDVQHSIEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVD
GRIYPVIKVQVWTRPELAGRVGCMRVGVDAWSRPNRALRTLTVFESFRD
 
Nucleotide Sequence: 990 bp     [Download]
>gi|126442307|ref|NC_009075.1|:763598-764587 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGACGCCGCTCGAGCGCGTGAGCCGGGCGCTGACGCCGCGCCGCACGTTCTTCGAGCTGATGCGGCGCG
TCGAGGCGCTGCAGCGCAGGCACGACGGGCGTTCGGCGCGCAAGCGCCGGATGCCGAAGTGGCTGCGCAT
CGAGCAGCCGGCGCAGATGCACTTCGCGAGCACGGAAGTCGAGCGCGTGCAGGTGACGCTCGCGCGCTTC
GTCGAGGACGACGATCACCCGCAGGTCACGGTGGCGCAGCGCCATTTCGGGCTGTTCGCGCCGTACGGGC
CGCTGCCGCTGCACGTGACCGAGCACGCGATGCAGGAGAAGCGCTTCGAGCGCAACGCCGCGTTCGAGCG
CTTCGTGAACGTCGCGTGCGGCGATCTCGCGTGGCTGCATTACTCGGCGTGGTCGTCGATGCATCCGGTG
CTCGGCTACGAGCGCGCGCGCAATCCGTTCGTCGAGCGCGTGACTGCGCTCGCCGATGCATGCCGCGCGC
AGCAGGACGACGGCGAGCCGTACGGGCGGCACGCGCTCGCATGCCGGCGCGCGTTTCCGGGCATCTACTG
CGCGCCGCGCCGCTCGCTGGCCGATCTGCAGCGGCTGCTGCGCGCGTACTTCGGCGTGGCGCTGCAGGTC
GTGCCGCGCCACGGGCGCTGGGTGCCGGTGCCGGCCGCGGCGAGCCATGCGCGGCGGCTCGGCGGCTGGC
GGCTGGGCGCGCGGATCTGGGACGTGCAGCACTCGATCGAGATCGTGGTGGGGCCGATCGAGGCGGACGA
GTTCTACCGGTGGCAACGCCGCGCGGCCGCCGTGATGGCGCTGTCGGCGGTCGTGACGGATTTCGTCGAC
GGACGGATTTACCCCGTCATCAAGGTTCAGGTGTGGACGCGCCCTGAACTCGCAGGAAGGGTTGGGTGCA
TGCGTGTCGGGGTCGACGCGTGGTCACGGCCGAATCGGGCGCTGCGCACCTTGACTGTCTTTGAATCTTT
TCGGGACTAG