SecReT6
Protein ID: 126444584
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2124
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2058658..2060157 [+]
Producthypothetical protein
NoteTssC
UniProt IDA3NL97
KEGG IDbpd:BURPS668_A2124
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-187, Aligned region: 72..497
Protein Sequence: 499 a.a.     [Download]
>gi|126444584|ref|YP_001063118.1| hypothetical protein BURPS668_A2124 [Burkholderia pseudomallei 668]
MEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQA
TIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPD
ITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSF
GKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFL
WGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQG
FIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSW
KERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTL
SLVGKLEKR
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2058658-2060157 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGCCGGACGCGACGCCGCCCGAGTCCCCCG
CCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCGCGACGAAGACGCATACCCGATCACGCG
CCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAGCGCCCGATCGAGACCGTGAGCCAGGCG
ACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCCGGCAGATCGACGCGATCCTCCATGACC
CGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTTTCTCGTCGATCGAACGGATTTCCGCGA
GAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTGTTCGACGACTTCGAGGATTCGCCCGAC
ATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGTACGGCCAATTCGGCGGCCAGCCGATCG
GCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGACGTCAAGCTGCTGCAGTACGTCGCGAG
CACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGCCCCGCGTTCTTCGGCATCGATTCGTTC
GGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGGGGCCGCAATACGCGAAATGGAATGCGT
TTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCTTGCTGCGGCTGCCTTACGG
CGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGCGTCGACGGCGGCGACGCGCATTTTCTG
TGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGAGCTTCGCCGACTATCGCTGGTGCGCGA
ACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCCGCTCTACGCGTACGAATCGATGGGCGA
GATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGCCGCGAGTTCGAGCTCGCCGAACAGGGC
TTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCTTTTTCTCCGCGAACTCCACGCAGAAGC
CGAAGTTCTTCGGCATCAGCAAGGAGGGCAAGGAGGCCGAGCTCAACTACCGGCTCAGCACGCAACTGCC
GTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTGATCCAGCGGGAAAACATCGGCTCGTGG
AAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCCGCCAGTACGTCGTCGACATGGACAACC
CGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCAGATCGTCGTGTCGGACGTCGAGGGCGA
ACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTCAAGTACATGGGCGCGTTCTTCACGCTG
TCGCTCGTCGGCAAGCTCGAAAAGCGCTAG