SecReT6
Protein ID: 126444660
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0161
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]140998..142347 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3NFP6
KEGG IDbpd:BURPS668_A0161
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|126444660|ref|YP_001061167.1| hypothetical protein BURPS668_A0161 [Burkholderia pseudomallei 668]
MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKLVFKSGAGIFP
DGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQAGSLARYSAFEIELRDSNAIGQG
PKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQLHGL
AKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFV
RPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYSSLV
LAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGPFWE
QIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|126442307|ref|NC_009075.1|:140998-142347 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAGTTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCTTCCCCAGCTGTTTCAACAACAGG
AACGGTACTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGCCCGTTTTTCTGGGGATTCAGCCG
ATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCAAGAGCGGTGCGGGAATATTTCCC
GACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCCGCTGACGATTGCCGCCGAGCATC
AGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTGCCGAATACGGAGGAGACCGCGTTCGACGAACA
AGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCGACAGCAATGCGATCGGTCAAGGG
CCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGAAAAGGAGCTGACGCAGTCCTGGA
TCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGCTCGGTCGCGCTGTACGACGGTGACCA
CATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAATGGGCGACCCAGTTGCATGGCCTC
GCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGATGGCCGGGCCGGGGCGGCGGCCG
AGGTGGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAACCGCTGCTCGAGCACATCTGCAGGAT
TCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGGCAGGCGAATTGTCGACGTTCGTG
CGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGCGCAGTTGTATGCGAGCATTCGCC
CGCTGGTCGACGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGAGGCGCGCAGCCGATCCCGCTCAC
CGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAACTCGCGGGCTATTCGAGCCTCGTG
CTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTTCGCATCCCAAACGAAGATCAGCC
ATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATGACGATGATTCCGTTGCCGGTGCC
TCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTATCCCGCACGGGGCCGTTCTGGGAA
CAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTTCCCTGAACTCAAGCTCGAACTTT
GGGGAGTGCGTCACAAATGA