SecReT6
Protein ID: 126444802
SecReT6 ID180
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0338
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]305422..306003 [+]
Producthypothetical protein
NoteTssE
UniProt IDA3NG73
KEGG IDbpd:BURPS668_A0338
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-17, Aligned region: 60..169
Protein Sequence: 193 a.a.     [Download]
>gi|126444802|ref|YP_001061344.1| hypothetical protein BURPS668_A0338 [Burkholderia pseudomallei 668]
MDAHETRADAPRNGDEACVRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQR
DLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVV
APSRAAGAVARPNVLAFEVRGMIRMDSYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 582 bp     [Download]
>gi|126442307|ref|NC_009075.1|:305422-306003 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGATGCGCATGAGACGCGCGCGGACGCGCCGCGCAACGGCGACGAGGCGTGCGTGCGCGGCGAAGGCC
TCGCGACGCCGCGCCGCGCGAACACGCAGCTGCTGCCGACGCTGATCGACCGCCTGCGCGACGACGCGCC
GCAACGGCAGACCGAAGCGCCCGGCGAATATGCGCTCACGCGCATGCAGATGCGCGGCATCGTCCAGCGT
GATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAACGCCATCCGGCCGCCG
CCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGTCGTGCCAGTGGGCGGA
GGTCGAACGCATCATCCGCCGCGTGATTCTCGATTTCGAGCCGCGGCTGATCGCCGAGACGCTCGTCGTC
GCGCCGTCGCGGGCCGCCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAGGTGCGCGGCATGATTC
GTATGGATTCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAACGAACCAGGTCAACAT
CACCGGCATGCGCGCGAGCTGA