SecReT6
Protein ID: 126444854
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0173
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]161410..161928 [-]
Producthypothetical protein
NoteTssE
UniProt IDA3NFQ8
KEGG IDbpd:BURPS668_A0173
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-20, Aligned region: 38..148
Protein Sequence: 172 a.a.     [Download]
>gi|126444854|ref|YP_001061179.1| hypothetical protein BURPS668_A0173 [Burkholderia pseudomallei 668]
MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRIVQRDLSLLLNTSNLDDEVDARRYPL
VSASVVNYGVPPLAGSYLHDRNRETIERLVRTAIAHFEPRLIADSLAIRPLAAQPGASYNKLTFEISALV
QWSPYPLELRIQSTFDLELNRVTLEKTTLNGN
 
Nucleotide Sequence: 519 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c161928-161410 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCGGCATCCTGAGGGACGGCATCGGGCCGCCTATCTTCCGTCGCTGCTCGACCGGCTGCAAGACGACG
CGCCGCACGCGCTCAGCGAATCGCCCGATGCCTATGCGCCGAGCGCCGACGAAATGCGCCGCATCGTGCA
GCGAGACCTGAGCCTGTTGCTGAACACCAGCAATCTGGACGACGAGGTGGACGCCCGCCGCTATCCGCTC
GTGTCGGCATCTGTCGTCAACTATGGCGTGCCGCCTTTGGCGGGCAGCTATCTGCACGACCGGAACCGGG
AAACGATCGAGCGCCTCGTGCGCACCGCGATCGCCCACTTCGAGCCGCGCCTCATTGCGGACTCCTTGGC
GATCAGGCCGCTCGCGGCGCAACCGGGCGCCAGCTACAACAAATTGACGTTCGAAATCAGCGCGCTCGTG
CAATGGTCGCCGTATCCGCTGGAGTTGCGCATCCAGAGCACGTTCGACCTCGAATTGAATCGAGTCACGC
TCGAGAAGACGACGCTCAACGGAAATTGA