SecReT6
Protein ID: 126444974
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0162
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]142344..143645 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3NFP7
KEGG IDbpd:BURPS668_A0162
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-61, Aligned region: 62..268
OmpA [PF00691], Evalue: 6.20E-18, Aligned region: 21..37
OmpA [PF00691], Evalue: 6.20E-18, Aligned region: 327..425
Protein Sequence: 433 a.a.     [Download]
>gi|126444974|ref|YP_001061168.1| hypothetical protein BURPS668_A0162 [Burkholderia pseudomallei 668]
MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAARAEPARDRIDASVNVQHRLDEVRAAANPLLEAATP
LLRMLADMPATLDTSEAVASLRTLLVREVALFQNLCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGG
VWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQR
LWTLITGARDAIQPELSLRWRGAEPGRLPLLRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARIL
AIAKEEPATPPQRLRLSILLKNEIARGLLTVDEDDRRSVVVFRGDAMFRSGESRVLPEIEPVLDKVAREV
ARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADRIRSEGRGDAQPVAENATPAG
RSRNRRVEIAVTL
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|126442307|ref|NC_009075.1|:142344-143645 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAATTCGGGCGCCTTTGACGAAGCCGCGTTCGATTTTCTCGTATCGGACGAAGGCGGAGCGAACGTCG
CGGCCGATCGCGCGCGATCGGCCGCGAAGGCCGCGCGCGCGGAGCCGGCGCGCGATCGGATCGACGCGTC
GGTCAACGTTCAGCATCGCCTCGACGAAGTTCGCGCGGCGGCCAATCCGCTGCTCGAAGCCGCGACGCCT
TTGCTGCGGATGCTGGCGGACATGCCTGCGACGCTAGACACCTCCGAAGCCGTCGCGAGCCTTCGCACGC
TGCTCGTGCGCGAGGTCGCGCTGTTCCAGAACTTGTGCGAGAAGGCCGATTTGCCTTGGAAGCACATGGC
GGTCGTGCGCTATTGCCTGTGCACCGCACTGGACGAGGCGGCCAATCGCACGCGCTGGGGCGGCGGCGGC
GTATGGGCTTCGCAGAGCTTGCTGATTACATACGAAGGCGAGGTCGACGGAGGCGAGAAGTTCTTCCTGT
TGATTGGACGCATGGCGACGGATCCTCAGGAGTACGTCGATATTCTCGAGATTCTCTATCGCGTGCTGGG
TCTCGGGTTCGAAGGGCGCTACAGCGTCGTTGCGGACGGCCGGCGGCATCTCGAGCAGATTCGCCAGCGT
TTGTGGACGCTCATCACCGGCGCGCGCGACGCGATTCAGCCGGAATTGTCGCTGCGCTGGCGCGGAGCGG
AGCCGGGCAGGCTTCCGCTGTTGCGCAGCGTGCCCGCATGGGCGAGCGGTGCGCTCGTCTTCCTGCTGTT
GTTCGGTCTCTTCGCGTTCTATCAGTATCGGTTGCTCACCGAACGCAATGCGCTCGAGGCGCGCATCCTG
GCGATCGCGAAGGAGGAGCCGGCGACGCCACCGCAGCGTTTGCGCCTGTCGATCCTGCTCAAGAACGAAA
TTGCGCGCGGTCTACTGACGGTCGACGAAGACGATAGGCGCAGCGTGGTCGTGTTCCGCGGCGATGCGAT
GTTCCGCTCCGGCGAGAGCCGCGTGCTTCCCGAGATCGAGCCGGTGCTCGACAAGGTGGCGCGGGAAGTG
GCCCGCGTCGGCGGCCGGGTCACGGTCACGGGGCACTCCGACAACCAGCCGATTCGGCGCGCCGACATCC
CGAACAATCTCGTGTTGTCGGAAAAACGCGCGGCTTACGTCGCGCAAATCCTGGTCCAGCGAGGCACTCC
GGCCGATCGTATTCGCTCGGAGGGCCGGGGCGACGCGCAGCCCGTCGCGGAAAACGCGACGCCTGCTGGC
CGATCCCGCAACCGCCGCGTCGAAATCGCGGTCACGCTGTAA