SecReT6
Protein ID: 126445261
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2971
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2826955..2828388 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA3NNP1
KEGG IDbpd:BURPS668_A2971
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.40E-10, Aligned region: 29..96
Protein Sequence: 477 a.a.     [Download]
>gi|126445261|ref|YP_001063962.1| FHA domain-containing protein [Burkholderia pseudomallei 668]
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDACLLKNLSSVS
TIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAATTAAAAAPAASAAQAQAKGAGYKL
WGLLHERFGLGKAQGAGEQSGARAAPSRHHDSPASAAPRDLNQLSTDPLDLFAQPRGDPDARAGAAREGE
GRAPPTVTQPDHAPEWTQHVRVQPAQSAPPAASRPGAPAARSGDIPAAGDASDMPSRVRASPAPAPATPE
TLLQAFFEGAGLDTAAEQHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPLK
LLPDGSAVLRQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPHW
YEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2826955-2828388 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGCAACTGACCGTTATCGAACACGCGGGCGAGCCGGTCGGCACCGACGGCCGCAACGCCGTCGTGTTTC
ATGCGCCGGGCGGCACGATCGGCCGGGACAGCGACAATCACCTCGTGCTGCGCGACGACACCCGGCAGAT
CTCGCGCCTGCAGGCGCTGCTGCAGGTGGCCGACGACGCGTGCCTGCTGAAGAACCTGAGCAGCGTATCG
ACGATCGAAGTGAACCGCGTGCCGATCGGCTACGCGCAGGCGCAGCGCCTGAACATGGGCGACATCATCC
GAATCGGCCCTTACCTGCTGCGCGCGGAGCCCGACGACGCGACGATCGAGCGAACCGTCGAAGCCGCCAC
CACGGCGGCCGCGGCGGCGCCGGCGGCGTCCGCCGCGCAGGCTCAGGCGAAGGGGGCGGGCTACAAACTG
TGGGGCCTGCTGCACGAGCGCTTCGGGCTCGGCAAGGCACAGGGCGCGGGCGAGCAGTCCGGCGCGCGCG
CCGCGCCGTCGCGCCACCACGATTCGCCGGCGTCCGCTGCGCCGCGCGACCTGAATCAGCTGTCGACCGA
TCCGCTCGACCTGTTCGCGCAGCCGCGCGGCGATCCGGATGCGCGAGCCGGCGCTGCGCGCGAAGGCGAA
GGCCGCGCGCCGCCCACCGTCACGCAACCGGATCACGCGCCCGAGTGGACGCAACACGTCCGCGTGCAGC
CGGCGCAATCCGCGCCGCCCGCCGCCTCTCGCCCCGGCGCGCCCGCCGCGCGTTCGGGCGATATCCCCGC
AGCAGGCGATGCGAGCGACATGCCGTCGCGCGTGCGCGCGTCGCCGGCCCCCGCGCCGGCGACACCCGAG
ACATTGCTGCAGGCGTTCTTCGAAGGCGCGGGGCTCGACACCGCCGCCGAGCAGCATCACTGGTCCGCCG
AGCAGTTGTTCGTCGCGGGGCAGCTGCTCGCGCTGTTCGCCAACGGCACGGTCGAGCTGCTGTCGTCACG
CAGCATCCTGAAGCGCGAAGTGAAGGCCGACATGACGATGCTGCTCGACCGCGAGAACAATCCGCTGAAG
CTGCTGCCGGACGGCAGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTGCCGGGCTTCATGACGCCGC
AAAGCGCCGTGTCCGACGCGTTCCAGGATCTGCACGCGCACCAGATCGGCATGGTGGCCGGCATGCGCGC
CGCGCTGATGGATCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCGCGACGCCGCGCCCCACTGG
TACGAGAAGCGCGTGCCGGCGCTGTACAAGGCGCGCCTCTGGGACCGCTATGCAACCACGCATCGCGACA
CGCTGTTCGCGATCGAGGACGATTTCGCCTCCGTGTTCGGCAAGGCGTTCCTCAGCGCCTACGACGCGGA
AGTCGAGAGCTATCGCGGACGCTGCCGCCGGTGA