SecReT6
Protein ID: 126445356
SecReT6 ID182
T6SS typei1
Gene symbol-
Locus tagBURPS668_A2123
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2058140..2058634 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3NL96
KEGG IDbpd:BURPS668_A2123
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|126445356|ref|YP_001063117.1| hypothetical protein BURPS668_A2123 [Burkholderia pseudomallei 668]
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKDDFNDVMRAQN
LQLTLSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRR
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2058140-2058634 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGACAACGAACGGATCCGTCGCGCCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACG
CGCAGGCGGAGGTCGAGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCTGCCGACAAGCC
GCCGCTCGAGGAGCTCTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAAC
CTCCAGCTCACGCTCAGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCA
CGCTCGGCTTCGATTCGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCA
GCTGATCGCGCTGCGCGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAAC
AATGA