SecReT6
Protein ID: 126445429
SecReT6 ID179
T6SS typei3
Gene symbol-
Locus tagBURPS668_A0157
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]137568..138107 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3NFP2
KEGG IDbpd:BURPS668_A0157
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-61, Aligned region: 11..163
Protein Sequence: 179 a.a.     [Download]
>gi|126445429|ref|YP_001061163.1| hypothetical protein BURPS668_A0157 [Burkholderia pseudomallei 668]
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPAVGDRKFFSIDIDNF
DERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKS
GAENLVSKVLKDPALLSALAKAPKPVAEQAENRESKEKH
 
Nucleotide Sequence: 540 bp     [Download]
>gi|126442307|ref|NC_009075.1|:137568-138107 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGGCTATATCCAATAGCTCACAGAAATTTATCGCGCGCAATCGTGCGCCTCGCGTTCAGATCGAATACG
ACGTCGAGATTTACGGTTCCGAAAAGAAGGTCGAGCTTCCGTTCGTGATGGGCGTGCTCGCGGACCTGTC
GGGCAAGCCGCTCGAGCCTCTGCCGGCGGTCGGCGACCGCAAGTTCTTCAGCATCGATATCGACAATTTC
GACGAGCGCATGAAGGCGATGAAGCCGCGTGTCGCGTTCTCGGTGCCGAATACTCTTTCCGGCGACGGTC
AATTGATGGTCGACATCACGTTCGAAAGCATGGACGACTTTTCTCCCGCGGCGATCGCGAAGAAGGTGGA
TGCGTTGTCGCAATTGCTGGACGCGCGCACGCAGCTTGCCAATCTGCAGACCTACATGGACGGAAAGTCG
GGCGCGGAGAACCTCGTGAGCAAGGTGCTCAAGGACCCCGCGCTGCTGAGCGCGCTTGCGAAGGCGCCGA
AGCCCGTGGCGGAACAGGCGGAAAACAGGGAATCGAAGGAAAAGCACTGA