SecReT6
Protein ID: 126445460
SecReT6 ID183
T6SS typei3
Gene symbol-
Locus tagBURPS668_A2957
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2810773..2811333 [-]
Producthypothetical protein
NoteTssE
UniProt IDA3NNM7
KEGG IDbpd:BURPS668_A2957
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-22, Aligned region: 50..164
Protein Sequence: 186 a.a.     [Download]
>gi|126445460|ref|YP_001063948.1| hypothetical protein BURPS668_A2957 [Burkholderia pseudomallei 668]
MNDDVRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGE
DGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAA
GERRHNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 561 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c2811333-2810773 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAATGACGACGTGCGAGCCGCGGGCGGCGGAGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGC
CGGCGCTGCTCGACCGGCTGACCGACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGAT
CGGCGGCGAGCGCCTGCGCGCGGCGGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAG
GACGGCTTCGTCGACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGC
TCGTCGGCAAGCCGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCG
TTTCGAGCCGCGTATCGCGCCCGACAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCG
GGCGAGCGCCGGCACAACGTGCTGATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCG
AGTTCGTGCTGCGCTCGGACCTCGATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTG
A