SecReT6
Protein ID: 126445588
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1686
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1628301..1629698 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3MF33
KEGG IDbmn:BMA10247_A1686
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-98, Aligned region: 16..462
Protein Sequence: 465 a.a.     [Download]
>gi|126445588|ref|YP_001078869.1| hypothetical protein BMA10247_A1686 [Burkholderia mallei NCTC 10247]
MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIRSARLLFADRS
YVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRYATLPSAEEVADL
HSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRC
IRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVG
ELSVFSECFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQRS
AQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1628301-1629698 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGACAACGTCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTGGCCGAACTGCACC
AGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGGCCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCT
CGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAGATCCGCTCGGCGCGCCTGCTGTTCGCCGACCGCAGC
TACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCC
GCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCTCGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGC
GCCCGACGCGTTGCCCGACGCCCCGACGCGCTACGCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTG
CATTCGGACCATCCGGGCGCGCCGGTGCGCACGCTCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGC
TCGACGCGCTCGCCGCGCACGAAACGATCCCGATCGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCT
CGACGACGATTTCGCGCCGCCCTGCTACGCGCTGTCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGC
ATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGTTGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCG
CCGAATTCGACGCGAGCTATGCGGCGTTCCTGCTCGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCT
GTTCCATCTCGCCGAATGCGACGGGCAGCATCCATGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGC
GAGCTGAGCGTGTTCTCCGAGTGCTTCGACATGCTCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGC
CGTACGACCACCGCGATCTGGGCGGCTGCTTCTCGCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGA
AATCGCGGTGGGCCCGGACTGCGTCGCGACGTTCGAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCG
GCGCAACTGCCGCCCGACGTGTTCGCGGATCGCCACCAGATCTATCTCGCGATCCGCAGCGCGCACGATC
CGGACACGCTCGCGCAACGCTTCGCGCTCGGCGGCCGGATCGCGGCGACCGACGAAATGCCGCAGCTCAC
CGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGCCTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGC
GACGCGCGCTACTTCCGGATCGAGCAGGCCGGCCGCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGT
CGCTGCGCTGGGCCGACGCGCCCGACGACCTGCACGCGGAACTCGTCGCAGTGAGGCACACGCAATGA