SecReT6
Protein ID: 126445951
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1676
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1613198..1613659 [+]
Producthypothetical protein
NoteTssE
UniProt IDA3MF23
KEGG IDbmn:BMA10247_A1676
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.10E-19, Aligned region: 39..130
Protein Sequence: 153 a.a.     [Download]
>gi|126445951|ref|YP_001078859.1| hypothetical protein BMA10247_A1676 [Burkholderia mallei NCTC 10247]
MADRESSRAGEPRTLERRLLERIANREAGGERDRPPPADVLAHSIIDHLRRILNTRQGHVPIDPAFGVPD
FTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTT
VTGNGKIDIRTIS
 
Nucleotide Sequence: 462 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1613198-1613659 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGCTGATCGCGAATCGTCGCGGGCCGGCGAGCCGCGCACGCTCGAGCGCCGGCTGCTCGAGCGGATCG
CGAACCGGGAAGCGGGCGGCGAGCGCGATCGCCCGCCGCCCGCCGACGTGCTCGCGCACTCGATCATCGA
CCACCTGCGCCGCATCCTGAACACGCGGCAGGGCCACGTGCCGATCGATCCCGCCTTCGGCGTGCCGGAT
TTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAAATCGAAGCGCAGATCGAGCGCGTGA
TCACTTGCTACGAGCCGCGGCTGAAAGCGCCGCGCGTCTCGCTCGCCGAGCGCGGGCCCGATGCGGCGAC
GCTGCGCTTCAGCCTCGATGCGCGGCTCGTGATCGACGCGCACGACGTGCCGGCGCGCTTTCTGACGACC
GTCACCGGCAACGGAAAGATCGATATCCGAACGATTTCCTGA