SecReT6
Protein ID: 126445998
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1680
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1619509..1622532 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA3MF27
KEGG IDbmn:BMA10247_A1680
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-67, Aligned region: 46..349
Phage_base_V [PF04717], Evalue: 3.00E-16, Aligned region: 396..489
Protein Sequence: 1007 a.a.     [Download]
>gi|126445998|ref|YP_001078863.1| Rhs element Vgr protein [Burkholderia mallei NCTC 10247]
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVSRQLRIDFAKM
LSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIV
KRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQ
PGPADDLALRYLPATSLDAGIEADRVQAFTCRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVS
SDEHFHTKDEGQRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQA
HLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVT
RRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLK
CSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAG
QDASALLQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGVTGVSTA
LMATSRTLLANVAKLQEALPLVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSV
GKGRWGVEAAKHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSAVRMSASDAQL
GFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVSAT
DVKLNGTNVKLNGSASLKFDGQLIQLG
 
Nucleotide Sequence: 3024 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1619509-1622532 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCCTTCGTCCCCCCGCCACGATGCGCCCGCGTCGCGCGCGAACGCCGCGCCGTCCGCGAACGCGCGAC
GCTTCACGTTCGCGAGCGACGCGTACGACCCCGCGACATTCGACGTCGTCGACATCAACGGCCGCGACGC
GATCTCGCAGCCGTACCGGTTCGAGATCACGCTCGTGAGCAGGCAGTTGCGGATCGACTTCGCGAAGATG
CTGAGCCGCGGGGCGACGCTCGCGATCCTGCCGCCGTTCGGCGAGGCCGGCACCACCCGCTATGCCGGCG
TGCTCGCCGAATTCGAGCAGAAGAAACGCTTTCGCGACTTCACCGTCTATCGCGCGACGCTCGTGCCGCG
CCTCTGGCGACTATCGCTGTACAAGGCGTCGGACGTCTATCTGAACGAGCAGACGATTCCCGACATCGTC
AAGCGCGTGCTGCGCGCCGCCTCGTTCGGCAGCCGCGATTTCCGCATGCGGCACGGCGGCGGCTACCGCA
AGCGCAGCTTCGTCTGCCAATACGACGAGAGCCATCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGG
CCTCTACTACTACTTCGAGCATGACGGCCGGCACGAAACGCTCGTGATCGTCGACGACCGCCGCCATCAG
CCCGGCCCCGCCGACGATCTCGCGCTGCGCTACCTACCCGCGACCAGCCTCGACGCGGGCATCGAAGCGG
ACCGCGTGCAGGCGTTCACATGCCGGGCGACGCCGCTGCCGCGCGAAGTCGTGCTGCGCGACTTCAACCA
CCGCAAGGCGGAGCTCTCGCTCGAAGTCCGCGAGCGCGTGGCGCGCGACGGCGTCGGCGAGCGGGTGTCG
AGCGACGAGCACTTCCACACGAAGGACGAAGGGCAGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTCT
GCGAAGGGCGCCGATTCGCCGGCGAATCGACCGCGGCCGGGCTGCGCGCCGGCCGCTTCTTCGCGCTGTC
GGGCCACTACCGCGAGGATTTCGACGGCCGCTATCTGGTGACGGCGCTCACGCATCGCGGCTCGCAGGCA
CACCTGCTGTTTCCCGATCTCGACGCGCCGTTCGGCGCGACGCCGGGCGAGCCCATCTACCGCGCCGAGT
TCGAGGCGATTGCCGCCGACCTCCAGTACCGGCCGCCGCGCACGACGCCCAAGCCGCGCGCGGCGGGCGT
CGTCAGCGCGATCGTCGACGGCGAGGGCGGCGGCAAGCTCGCCGAGCTCGACGAATACGGCCAGTACAAG
GTGCGCTTTCCGTTCGCGCACACCGCGCATCCGGCGAACAAGGCCTCCGCGCGCATCCGGATGGCGACGC
CCTACGCGGGCGACGACCGCGGCATGCACCTGCCGCTGCTGAAGCGCACCGAAGTGAAGATCGCATTCGA
CGGCGGCGATCCGGACCGCCCCGTGATCGTCGGCGCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACG
CGCCGCAACCCCGCCGAGCATCGCATCCTCACCGAGCACAACCAGCTCTACATGAAGGACGGCAGCGGCG
CGGCGACGTGGCTGCACGCGCCGAACAACCACATCGGCATCGGCGCGGTCGGGCCGGGCGACGGCCTCGC
GCTCCTCACGTCCGGCAACAAGTTCGACTTCTCGCTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAG
TGCTCGGTGTCGATGGGCGGCAACACCGACGTCTACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGA
ACTTCCTGACGACGCTGCAGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGGAGCTTCGAGATCAACGA
CAGCGCATCGACACTGCTGCAGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGG
CAGGACGCGTCCGCGCTGCTGCAAAAGCAGCTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCG
TGTCGGGCCTCGCGAACGCCGGGTCCGCGGCCGCCGCCGCGGGGCTCATCAAGGGCGGCGGCAAGCTCGC
CGATCTGCCGTGGGCGGGCTTCGGCATATCCGCCGCGCAGTTCGCCGGCGTGACCGGCGTCAGCACGGCG
CTGATGGCGACCTCGCGCACGCTGCTCGCGAACGTCGCGAAGCTCCAGGAGGCGTTGCCGCTCGTCGCCG
ATCTGTCGCTCGGCAAGCAGGGCATCGCGCTCGCCGCGAAGAACCTCACGCACGCGACGCGGATGTCGCT
CACCGTCGACGGCGTCTCGTGGTCGACGCACGCGAAGGGGCCCGGCGCGGCGGGCGCCGCGATGAGCGTC
GGCAAGGGCCGCTGGGGCGTCGAAGCGGCGAAGCACGCGCACGTCCACGCGAGCGACACGCTGCTGTTCG
CGGTGCCGGCCGACCCGACGACCCAGTTCGACCTGAAGGACCTGATCGGGCTGCGCCGCGATCTCGACGA
ATGCATGAAGGACATCGCCGATCTCGAAGCCGACATTTCGGAAAACGAAGTGCTGTCGACCGATCAGAAC
ACGTTCGGCGTCAGCGCGCTCATCCCCACGCCGCCGTCGCCCGCCGGCGCGCTCGCGGCGGTCGCGATCA
AGGTGAAGCAAGCGAAGCTCGTCGAGCTGAAGGCCAAGCAGAAGCTCGTCGCGCTGAAGGTCGACAACCT
GCAGCAGAAGTTCGCGAAGCACGTGCAGCACCTGAGCGCCGTGCGGATGAGCGCTTCCGACGCGCAGCTC
GGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCGACGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGA
AGCTCGACGTGCGCGAAGCGAAGATCGGCGTCACGGCGGGCAAATCGAGCGTCGAGCTCGACGAAGGCAA
GATCGCGGCCGGCTGCGGCAGCGCATCGCTGAAGCTCGGCAGCGACGGCGCGATCGACGTGAGCGCGACC
GACGTCAAGCTGAACGGCACCAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGTTCGACGGCCAACTGA
TCCAGCTCGGCTGA