SecReT6
Protein ID: 126446101
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1672
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1610459..1610953 [+]
Producthypothetical protein
NoteTssB
UniProt IDA3MF19
KEGG IDbmn:BMA10247_A1672
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.30E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|126446101|ref|YP_001078855.1| hypothetical protein BMA10247_A1672 [Burkholderia mallei NCTC 10247]
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKDDFNDVMRAQN
LQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRR
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1610459-1610953 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGACAACGAACGGATCCGTCGCACCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACG
CGCAGGCGGAGGTCGAGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCCGCCGACAAGCC
GCCGCTCGAGGAGCTCTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAAC
CTCCAGCTCGCGCTCAGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCA
CGCTCGGCTTCGATTCGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCA
GCTGATCGCGCTGCGCGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAAC
AATGA