SecReT6
Protein ID: 126446113
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0456
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]400458..401018 [+]
Producthypothetical protein
NoteTssE
UniProt IDA3MBM2
KEGG IDbmn:BMA10247_A0456
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-22, Aligned region: 50..164
Protein Sequence: 186 a.a.     [Download]
>gi|126446113|ref|YP_001077658.1| hypothetical protein BMA10247_A0456 [Burkholderia mallei NCTC 10247]
MNDDVRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGE
DGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAA
GERRHNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 561 bp     [Download]
>gi|126445587|ref|NC_009079.1|:400458-401018 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGAATGACGACGTGCGAGCCGCGGGCGGCGGAGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGC
CGGCGCTGCTCGACCGGCTGACCGACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGAT
CGGCGGCGAGCGCTTGCGCGCGGCGGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAG
GACGGCTTCGTCGACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGC
TCGTCGGCAAGCCGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCG
TTTCGAGCCGCGTATCGCGCCCGACAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCG
GGCGAGCGCCGGCACAACGTGCTGATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCG
AGTTCGTGCTGCGCTCGGACCTCGATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTG
A