SecReT6
Protein ID: 126446180
SecReT6 ID193
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2178
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]2116224..2116805 [-]
Producthypothetical protein
NoteTssE
UniProt IDA3MGG3
KEGG IDbmn:BMA10247_A2178
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-18, Aligned region: 60..170
Protein Sequence: 193 a.a.     [Download]
>gi|126446180|ref|YP_001079349.1| hypothetical protein BMA10247_A2178 [Burkholderia mallei NCTC 10247]
MDAHETRADAPRNGDEARVRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQR
DLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVV
APSRAVGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 582 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c2116805-2116224 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGATGCGCATGAGACGCGCGCGGACGCGCCGCGCAACGGCGACGAGGCGCGCGTGCGCGGCGAAGGCC
TCGCGACGCCGCGCCGCGCGAACACGCAACTGCTGCCGACGCTGATCGACCGCCTGCGCGACGACGCGCC
GCAACGGCAGACCGAAGCGCCCGGCGAATATGCGCTCACGCGCATGCAGATGCGCGGCATCGTCCAGCGT
GATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAACGCCATCCGGCCGCCG
CCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGTCGTGCCAGTGGGCCGA
GGTCGAACGCATCATCCGCCGCGTGATTCTCGATTTCGAGCCGCGGCTGATCGCCGAGACGCTCGTCGTC
GCGCCGTCGCGGGCCGTCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAGGTGCGCGGCATGATTC
GTATGGATCCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAACGAACCAGGTCAACAT
CACCGGCATGCGCGCGAGCTGA