SecReT6
Protein ID: 126446334
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0445
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]386022..386540 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDA3MBL1
KEGG IDbmn:BMA10247_A0445
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-38, Aligned region: 14..160
Protein Sequence: 172 a.a.     [Download]
>gi|126446334|ref|YP_001077647.1| putative lipoprotein [Burkholderia mallei NCTC 10247]
MRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSPIVLKVFQLKTASAFESADF
FSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNL
YRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 519 bp     [Download]
>gi|126445587|ref|NC_009079.1|:386022-386540 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCGACCGCGGTTCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGCTTGCCGGATGCGGGGCGACCG
AGCGTTCCGTTGCGGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCG
CAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTC
TTCTCGCTGCAGGACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGC
GCCCGGGGGATGCGCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGA
ATATCGCGTGCTCGAGAAGAACCGCTGGCGGATGACGGTGCCGCTGCCGCGCGCGAAGCAACTGAACCTG
TACCGATTCTGGCAAACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCC
TCGGCGGCGATTCGCGAGTACGCCAATGA