SecReT6
Protein ID: 126446426
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0458
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]402891..404369 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3MBM4
KEGG IDbmn:BMA10247_A0458
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-130, Aligned region: 81..439
Protein Sequence: 492 a.a.     [Download]
>gi|126446426|ref|YP_001077660.1| hypothetical protein BMA10247_A0458 [Burkholderia mallei NCTC 10247]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANVEANAEPDAMPNAVRGAAADVAPSAAPSATPSATSQAAA
ARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVRDDGP
RPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSLDRPA
RARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSLPDSPPDSSPDSPPDSRSDSPSDARLDP
HPDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRP
TQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEV
PTLALGSRHGLGRTAWLGERLDPGPARDLVLGYDERMRASRARSGAADQAAAAGALIANLPEREPPCPIS
AE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|126445587|ref|NC_009079.1|:402891-404369 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAATGTGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCAGTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCGAGCGCGACGTCGCAGGCCGCCGCC
GCGCGCCGCGACGCATGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGTTTCATGCGCTGC
GTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCGCGACGAGCCGGT
GCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGTGACGACGGCCCG
CGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGTCGCATCTGACCG
AGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGACCTGTTTCATCA
TCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTCGATCGGCCGGCG
CGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTGCCGATTCACCGC
GCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACTGCCTGATTCACC
GCCTGATTCATCGCCTGATTCGCCGCCTGATTCGCGGTCCGATTCGCCGTCCGATGCGCGCCTCGATCCG
CATCCCGACTCGCCGCGCGGCGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGG
TGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTATTTCGGTGTGCGGGTACGCAT
CGTCGAGCACGTGCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCG
ACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGC
TCGGCCCGCTGACGCTCGACGAATACCGGCGGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCA
ATGGGTGCGCGAATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTG
CCGACGCTCGCGCTCGGTAGCCGTCACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGACCCCG
GCCCCGCGCGCGACCTCGTGCTCGGCTACGACGAGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGC
CGATCAGGCGGCCGCCGCCGGTGCGTTGATCGCCAACCTGCCTGAACGGGAACCGCCATGTCCGATATCG
GCCGAGTGA