SecReT6
Protein ID: 126446436
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1670
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1608355..1610199 [-]
Productsensor histidine kinase
NoteVirA
UniProt IDA3MF17
KEGG IDbmn:BMA10247_A1670
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 7.60E-21, Aligned region: 454..592
MASE1 [PF05231], Evalue: 2.10E-15, Aligned region: 62..323
HisKA [PF00512], Evalue: 0.00055, Aligned region: 311..338
HisKA [PF00512], Evalue: 0.00055, Aligned region: 337..402
Protein Sequence: 614 a.a.     [Download]
>gi|126446436|ref|YP_001078853.1| sensor histidine kinase [Burkholderia mallei NCTC 10247]
MHGNSIDAGPPARARPARITRTARTAPRRDDRAFAPGGALNAAGLLLLLFYANHLLSRPGACTSLNHTLS
AVVWPAPVLGIALLLHCRRPLAWWLGAGSLFATLLAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRYL
IAGGGVDTLRGFAMFVLLLPLGMAAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTWN
ARACGAAWSRSRNQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIA
MTLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFS
NVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAARRGEPVLTRVSVDEVVDEALAA
TRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQLARAVMNLVGNAVRAARATVVVRVGVNGGVNGG
ASDGASRGANDGGAPAARAFDVAIGEAAMPGGVWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLGL
AIVAGAALAHRGQIAVATDRGAGSCFRLTLPAAWGTGAPGAMDAGAPGAVQERT
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1610199-1608355 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCACGGAAATTCCATCGATGCCGGGCCGCCCGCGCGCGCCCGGCCCGCACGCATCACGCGAACGGCGC
GCACCGCGCCGCGCCGCGACGATCGCGCGTTCGCGCCGGGCGGCGCGCTGAACGCGGCGGGGCTGCTGCT
GCTGCTGTTCTACGCGAATCATCTGCTGTCCCGGCCCGGCGCGTGCACGTCGCTCAATCACACGCTGTCG
GCCGTCGTGTGGCCCGCGCCGGTGCTCGGCATCGCGCTGCTGCTGCACTGCCGGCGGCCGCTCGCATGGT
GGCTCGGCGCGGGTTCGCTGTTCGCCACGCTGCTCGCCGCGGGCTCGCTCGACTGGGTGCCGTGGCACGT
CGACGCGCTGTTCGCGGCCGTCAACGTCGTCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGCGCTATCTG
ATCGCGGGCGGCGGGGTGGACACGCTGCGCGGCTTCGCGATGTTCGTGCTGCTGCTGCCGCTCGGCATGG
CGGCGATGCACGCGACGCTCGCGGCGGCGATCCTGTCGGTATGGATGAACGACCGCGAATGGCTGAGCGA
ATGGTCGCGCGCGTATGCGGCGAACGCGCTCGCGCTGCTCGTGCTGCTGCCGGCGCTCCTCACGTGGAAC
GCGCGCGCATGCGGCGCGGCGTGGTCGCGCAGCCGCAATCAGTTGCCGGTGCTCGCGACGTTCGGCTCGC
TGTGCTTCGCGTCGATATGGGGATACCAGGCCGAGGTCGCGCGCGCGCTGCTCGCGCTGTCGCTGAGCTG
GGCCGCGCTCGAGGGCGGCCTCGTGCTCGCGTCCCAGCTCAACGCGCTCTCGGCGATCGCCCTGATCGCG
ATGACGCTCGGCGGGCGCGGCCCGTATGCGTGGCATCACGACGGCCACGGCGTCTGGGCGCTGCAGGTCG
ATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGCGAGCGGCGGCGGCTTGCGCG
GCAGATCGAACGATCGCGCCGTTTCGAGTCGCTCGGCTTTTTCGCCGGCGGAATCGTGCACGATTTCAGC
AACGTGCTGACGACGATCGATTGCCACGCCGAATACGCGTCCGAGCGGCTCGCGAGCGGCGCGCGCGCGG
ACGATTCGATCGACGAGATTCATCGCGCGGTCGAACGCGGCCGCGATCTGGCGGCGCAGATCCTGCTCGC
CGCGCGCCGCGGCGAGCCCGTGCTGACGCGGGTGAGCGTCGACGAGGTCGTCGACGAGGCGCTCGCCGCG
ACACGCGCGGCCGCGTGGCGCGGCGTCGAGATCGTTCGATGCGGCGATGGCGCGCGCGACGGCGCCCGGC
GTGGCGACGTTCGTCACGTCGTATTCGCCGATCGCAGCCAGCTCGCGCGCGCGGTCATGAATCTCGTCGG
CAATGCGGTGCGCGCGGCGCGCGCGACGGTTGTCGTGCGTGTCGGGGTGAACGGCGGGGTGAATGGCGGC
GCGAGCGATGGGGCGAGCCGCGGCGCGAACGACGGCGGCGCGCCGGCCGCTCGCGCATTCGACGTCGCGA
TCGGCGAAGCGGCGATGCCGGGCGGCGTGTGGATCGAGGTGAGCGACGACGGCGAAGGCATCGACGTCGA
GCCGCTCGACCGCATCTTCGAGCCGTTCTATTCGAACCGCTCCGGCGCGCCGGGGACGGGGCTGGGTCTC
GCGATCGTCGCGGGCGCGGCGCTCGCGCACCGCGGGCAGATCGCCGTCGCGACGGATCGGGGCGCGGGCA
GTTGCTTCCGGCTCACGTTGCCGGCGGCATGGGGAACGGGCGCGCCCGGCGCAATGGACGCCGGCGCGCC
CGGCGCAGTACAGGAGAGGACATGA