SecReT6
Protein ID: 126446595
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0446
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]386537..387940 [+]
Producthypothetical protein
NoteTssK
UniProt IDA3MBL2
KEGG IDbmn:BMA10247_A0446
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-159, Aligned region: 30..466
Protein Sequence: 467 a.a.     [Download]
>gi|126446595|ref|YP_001077648.1| hypothetical protein BMA10247_A0446 [Burkholderia mallei NCTC 10247]
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGK
VALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGAGGNGEGHGGDGNA
HAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYI
PPRLVAQRDPVLLRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAA
HPETLFCDWLKLACDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGN
GMKVATIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|126445587|ref|NC_009079.1|:386537-387940 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGAACGAGCCGGTATTGTCCGCGACCCCCGCTGCGGCGTTGCGCCAGCGCGTGATCTGGACCGAGGGCA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAGCGGCACTGGGAGCGCTACGTCGGCATGCGCTGCCT
GCCGCTGCAAGGCTTCTACTGGGGCTACGACGAGTTGCAGATCGATCGCGAGCTGCTCGCGCTCGGCAAG
GTCGCGCTGCTCGCCGCGACCGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCGGACGACC
GGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGATCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCG
CGGCGGCGCGCAGGAGGTGTCGTTCGGCGCGGGCGGCAACGGCGAAGGCCACGGCGGCGACGGCAACGCG
CACGCGGGCTTCGCGCGCTACGTCGTGCGCGAATACGAAGTCGCCGACGCGAACGAGGTCGCGCTCGGCC
CCGCGCTATTGCAGACCGGCCGCCTGAACGTGCGCCTGATGCTCGAATCCGAATTGACGGGCGACTGGCA
GGCGCTCGGCGTCGCGCGCGTCGTCGAGCGGCGCACCGATGGGCGGCTGCTCGTCGACGACGGCTACATT
CCGCCGCGGCTTGTCGCGCAGCGCGATCCGGTGCTGCTGCGCCACACGCGCGAGCTGCACGGGCTGCTCA
CGCAACGCAGCGAGGCGCTCGGCGAGCGCCTGTCGGAGCCGGGGCGCGGCGGCGTGTCCGAAGTCGCCGA
TTTCCTGCTGCTGCAACTCGTCAACCGCTATCTGGCGCTCACGTGGCACGCGCAGCAGGATGTCGCCGCG
CACCCGGAGACGCTGTTCTGCGATTGGCTGAAGCTCGCGTGCGACCTGAGCACGTTCACCGCGGCCGGCC
GCCGGCCGCAGTCGCTCGCGGTCTACCGGCACGACGATCTGCGCGCGAGCTTCGGCGAGCTGATGGCCGA
GCTGCGCCGCTCATTGTCGACGGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGACGTGGGCAAC
GGCATGAAGGTCGCGACGATCGCCGATCCGGCGCTGCGCGACACCGCGGGCTTCGTGCTCGCCGTGCGCG
CCGACGTGCCGGCCGACAGCCTGCGCGCGCGCTTTCCCGCGCAGGCGAAGCTCGGTCCCGTCGAGCGCAT
TCGCGATCTCGTGCAGTTGCAACTGCCGGGCATCGCGATGCGGCAGTTGCCCGTCGCGCCGCGGCAGATT
CCGTATCACGCGGGCCACACGTACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAACAGCTCGAACGCT
CGGGCGGCCTCGCATTTCATTTCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCGCGG
GTGA