SecReT6
Protein ID: 126446670
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0457
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]401023..402894 [+]
Producthypothetical protein
NoteTssF
UniProt IDA3MBM3
KEGG IDbmn:BMA10247_A0457
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-218, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|126446670|ref|YP_001077659.1| hypothetical protein BMA10247_A0457 [Burkholderia mallei NCTC 10247]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARPAAAEQTACEFRTAHDLTLWP
LELADASVTGAPAYLPRSATAARRDVRGALRIRLKARGGAGLAQLPIDRLMFHLAGPERDALHLLELIAG
HTIGVVCHDAAQPPRWLHALGAHALAHQGFDADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRP
ALARATGDTFELTLLLDRHDAALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLD
YEVYAVRRLAGEQRDDGQTRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPRPPLADAQSAW
RLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRVAFAPVFRRLPAAGPLMFGRG
VQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPARVGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|126445587|ref|NC_009079.1|:401023-402894 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGATACGCGCCTGCTCGACTACTACAACCGCGAGCTCGCGTATCTGCGCGAGTTGGGCGGCGAGTTCG
CGCAGCAGTTTCCGAAAGTGGCCGCGCGCCTGCGGATGCACGAATCGGGGCCGCCCGATCCGTACGTCGA
GCGGTTGCTCGAAGGCTTCAGCTTTCTCACCGCGCGCGTGCAACTGAAGATGGACGCGGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGACGCGGTGTATCCGGGTTACGTCGCGCCGCTTCCGTCGATGGCGATCGTGC
AGTTCACGCCGATGATGAACGAAGGCAGCCTCGCGCAGGGCTACCGGCTGCCGGCGGGCACCGCGCTGCG
CGCGCGGCCCGCCGCGGCCGAACAGACCGCGTGCGAGTTTCGCACCGCGCACGATCTGACGCTGTGGCCG
CTGGAGCTCGCGGACGCTTCGGTGACGGGCGCGCCCGCGTATCTGCCGCGTTCGGCGACGGCAGCGCGCC
GCGACGTGCGCGGCGCGCTGCGCATCCGGCTGAAGGCGCGCGGCGGCGCGGGCCTCGCGCAACTGCCGAT
CGATCGGCTGATGTTCCACCTGGCGGGCCCCGAGCGCGACGCGCTGCATCTGCTCGAACTGATCGCCGGG
CATACGATCGGCGTCGTCTGCCACGACGCGGCGCAGCCGCCGCGCTGGCTGCACGCGCTTGGCGCGCACG
CGCTCGCGCATCAGGGCTTCGACGCCGATCAGGCGCTGCTGCCCGACGAAGGCCGCAGCTTCCACGGTTA
CCGGCTGCTGCGCGAGTACTTCGCGTTTCCCGCGCGCTTCCTGTTCTTCAGCATCGAAGGATTGCGGCCC
GCGCTCGCGCGCGCGACGGGCGACACGTTCGAGCTGACGCTGCTGCTCGATCGGCACGACGCGGCGCTCG
AGAACAGCGTCGATGCGCGGCACCTCGCGTTGAACTGCACGCCGGCCGTCAACCTGTTCGCGCGGCGCGC
GGACCGCATTCCGGTCCATCCGGGCGCGCGCGAGCATCATGTCGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTACGCGGTGCGGCGGCTCGCGGGCGAGCAGCGCGACGACGGGCAGACGCGCGCGTTCCGGC
CGTTCCATGCGTCGTTCGCGGGCGACGGCGGCAATTACGGCGCGTACTACACGGTGCGCCGCGAGCCGCG
CCTCGTGTCCGCGCAGGCGCGCGCGAACGGCACGCGCACCGGCTACGTCGGCAGCGAGACGTTCGTGTCG
CTCGTCGATAGCGCGTGCGCGCCGTATGACGAATCGATCCGCTATCTGTCCGTCGACACGCTGTGCACGA
ACCGCGATCTCGTCCTGCTGTTGCCGGCGGGCGACGCGAACGCGTTCACGCTGCGCGTGTCGGCGCCCGT
CGAGCGGATCGCCATGATCCGCGGGCCGTCGCGGCCGCGCCCGCCGCTCGCCGACGCGCAGAGCGCGTGG
CGGCTCGTGAGCCATCTCGGGCTCGCGCGCCACACGCTGACCGATGTCGACGACGAAGAAGGCGCGCGCG
TGCTGCGCGAATTGCTCGGCCTGCACGCGGACCCGGCCGATGCGGCGATGCGCCGGCAGATCGACGGTGT
GCATCGCGTCGCGTTCGCGCCGGTGTTTCGCCGGCTGCCCGCCGCCGGGCCGCTGATGTTCGGGCGCGGC
GTGCAGGTGGACGTGACCGTCGACGATCATGCGTTTTCCGGCGACAGCCCCTATTTGCTCGGTGCGGTGC
TCGAGCAGTTTTTCGCGCGGCACGTGTCGATCAACTCGTTCGCCGAATGCGTGCTGAGCAGCGCGCAGCG
CGGCAGGCTCGCGCAATGGCCGGCGCGCGTCGGCAGGCGGCCCGCGATATGA