SecReT6
Protein ID: 126446866
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1673
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1610950..1612476 [+]
Producthypothetical protein
NoteTssC
UniProt IDA3MF20
KEGG IDbmn:BMA10247_A1673
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-187, Aligned region: 81..506
Protein Sequence: 508 a.a.     [Download]
>gi|126446866|ref|YP_001078856.1| hypothetical protein BMA10247_A1673 [Burkholderia mallei NCTC 10247]
MNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPK
RPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTAL
FDDFEDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAG
PAFFGIDSFGKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEER
VDGGDAHFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISER
REFELAEQGFIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKV
IQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHF
KYMGAFFTLSLVGKLEKR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1610950-1612476 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGAACCGCGACACGGAACAGACGACCATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGC
CGGACGCGACGCCGCCCGAGTCCCCCGCCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCG
CGACGAAGACGCATACCCGATCACGCGCCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAG
CGCCCGATCGAGACCGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCC
GGCAGATCGACGCGATCCTCCATGACCCGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTT
TCTCGTCGATCGAACGGATTTCCGCGAGAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTG
TTCGACGACTTCGAGGATTCGCCCGACATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGT
ACGGCCAATTCGGCGGCCAGCCGATCGGCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGA
CGTCAAGCTGCTGCAGTACGTCGCGAGCACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGC
CCCGCGTTCTTCGGCATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGG
GGCCGCAATACGCGAAATGGAATGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCC
GCGCTTCTTGCTGCGGCTGCCTTACGGCGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGC
GTCGACGGCGGCGACGCGCATTTTCTGTGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGA
GCTTCGCCGACTATCGCTGGTGCGCGAACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCC
GCTCTACGCGTACGAATCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGC
CGCGAGTTCGAGCTCGCCGAACAGGGCTTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCT
TTTTCTCCGCGAACTCCACGCAGAAGCCGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCT
CAACTATCGGCTCAGCACGCAACTGCCGTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTG
ATCCAGCGGGAAAACATCGGCTCGTGGAAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCC
GCCAGTACGTCGTCGACATGGACAACCCGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCA
GATCGTCGTGTCGGACGTCGAGGGCGAACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTC
AAGTACATGGGCGCGTTCTTCACGCTGTCGCTCGTCGGCAAGCTCGAAAAGCGCTAG