SecReT6
Protein ID: 126446927
SecReT6 ID193
T6SS typei3
Gene symbolsciN
Locus tagBMA10247_A2187
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]2124789..2125292 [+]
ProductSciN protein
NoteTssJ
UniProt IDA3MGH2
KEGG IDbmn:BMA10247_A2187
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-40, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|126446927|ref|YP_001079358.1| SciN protein [Burkholderia mallei NCTC 10247]
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYELKTDGAFNAAD
FFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGTLGVVAAYRDLPNSVWRAAYPLPPARDAA
WYRFSSPKLKLTIELDTHAIRITEPGK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|126445587|ref|NC_009079.1|:2124789-2125292 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCATCCGACCACCCCCGTTGCCGCCGTCGCGCTCGCGCTCGCGTGCGCCGCGTGCGCGAGCGGCGCGG
CCAAGCAGAAGGAGCCGCTGCGGCTCGAGCTCGCCGTGCGCGCCGCGCCCACGGTCAATCCGGACGATCG
GAGCCGGCCGGCTCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCATTCAACGCCGCCGAT
TTCTTCACGCTGCAGGGCCCGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGCGTTTTCAAC
TGCGCCCCGGCGAGCGCCGCGTGATCCGGCGCGACGCCGATCCGGCGGCGGGCACGCTCGGCGTGGTCGC
CGCGTACCGCGATCTGCCGAACTCGGTGTGGCGCGCGGCATATCCGCTGCCGCCCGCGCGGGACGCCGCA
TGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGAGCTCGACACGCACGCGATCAGGATCACCG
AACCCGGAAAATGA