SecReT6
Protein ID: 126447024
SecReT6 ID191
T6SS typei1
Gene symbol-
Locus tagBMA10247_A1678
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1615426..1616448 [+]
Producthypothetical protein
NoteTssG
UniProt IDA3MF25
KEGG IDbmn:BMA10247_A1678
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-80, Aligned region: 11..311
Protein Sequence: 340 a.a.     [Download]
>gi|126447024|ref|YP_001078861.1| hypothetical protein BMA10247_A1678 [Burkholderia mallei NCTC 10247]
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDVERIDKADDGG
YRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPLLFDAWLKHRLALRIVEERDE
HALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPCVSQWLPIP
DDQRTRVGTRARRLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAV
DVVVRVRARDAAPARCGRRAWSRVGLDAWLGGPSAERAASPKFRLPTSLFDQARPHHAAG
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1615426-1616448 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCCTGCTCTAGAACCCGTTCTGCTCGGCGAGGCGAAGCACTTCGCGTATTTCCAGGCGATCCGGCTGC
TGCGGCGCATCGCGCGCGAACGGCGCGGCGACGCCGCGGGGCGGCCCGACGCGCCGCTGCCGATCCACAC
GCGGCCGAATCTCTCGCTGTCGTTTCCGGACACCGACGTCGAGCGCATCGACAAGGCCGACGACGGCGGC
TACCGGGTCGTCGCGAACTTCTTCGGTCTGTACGGCGTGTCCTCGCCGCTGCCGACGTTCTACACCGAGG
ACCTGATCGACGAAGCGTTCAGGGGCCGCCACGCGGCGCGCGGCTTTCTCGACGTGCTGCATCGCGCGCT
CTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGGCTGGCGCTGCGGATCGTCGAGGAACGCGACGAA
CACGCGCTGCGCCCGCTCTACGCACTCGCGGGCGTCGACGCGCGCATCGCGCGCGACGCGGGCCTGCACG
AGCACGCGCTGCTGCGCTACGTCGGGCTGCTCAGCCAGCGGCCGCGCTCCGCGGCCGGTCTGCGCGCGCT
GCTCGCCGACGCGTTCGCGCCCGCGACGGTCGACATCGAGCCGTGCGTGTCGCAATGGCTGCCGATTCCG
GACGACCAGCGCACCCGCGTCGGCACGCGCGCGCGCCGGCTCGGCGCCGACGCGCGGGTCGGCGCGCGCA
TGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTCGGCGACGTGCCCGGCCCGCTGTTCCGCGCGCTGAT
GCCGGGCGGCGATGCGTTTGCCCGGCTGCGCTTGCTCGTACGCCTGTATCTGACCCAACCGTTCGCCGTG
GACGTCGTGGTGCGCGTGCGCGCGCGCGACGCGGCCCCCGCGCGCTGCGGCCGCCGCGCGTGGTCGCGCG
TCGGGCTCGACGCGTGGCTGGGCGGCCCGAGCGCGGAACGCGCGGCGTCGCCCAAATTCCGTCTTCCGAC
TTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA