SecReT6
Protein ID: 126447095
SecReT6 ID190
T6SS typei3
Gene symbol-
Locus tagBMA10247_A0447
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]387956..389272 [+]
Producthypothetical protein
NoteTssL
UniProt IDA3MBL3
KEGG IDbmn:BMA10247_A0447
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 49..253
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 335..363
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 376..417
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 250..259
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 318..416
Protein Sequence: 438 a.a.     [Download]
>gi|126447095|ref|YP_001077649.1| hypothetical protein BMA10247_A0447 [Burkholderia mallei NCTC 10247]
MNTSSDSFSAGSGGFVPPNPGGAHPAAAPAAGAAAFQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTVH
HPNPAWLREHLVVEIRQFEERAQQAGVASEAIIGARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNET
WGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGRAQLDAVRRQLAQTIRSVRGEFDPA
LSPHWRDVVTRDVTRRFTVPLWVCVALALLVGFGVFAGLRIALAGHSDRLFASIDALHVPKLQPAPPAPH
PAPAPRVAKFLEPEIAAGLVSVRDEADRSVIVLRGDGLFGSGSTSVIDRYMPVLTRVADALNQVQGNVRV
SGYTDDTPVHTARFASNWDLSRERAQAVRSLIAARLDRPERITAEGRGTLDPVAPNDSPANRARNRRVEI
TLMLAPGSDAARATKEAP
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|126445587|ref|NC_009079.1|:387956-389272 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGAACACTTCTTCCGATTCGTTCTCGGCCGGCTCGGGCGGATTCGTGCCGCCGAATCCGGGCGGCGCGC
ACCCGGCCGCCGCGCCGGCGGCGGGTGCGGCCGCGTTTCAGCCGAGGCCGGGCCGCTGGGCGGCGAGCGG
CACGAATCCGCTCGTCGCGGCCGCGAACCCGCTGTTGAACCTCGTGCCGCAGATCCGTTCGACCGTCCAT
CATCCGAATCCCGCGTGGCTGCGCGAGCATCTCGTCGTCGAGATCCGCCAGTTCGAGGAGCGCGCGCAGC
AGGCGGGCGTCGCCTCCGAGGCGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCCGC
CGCGCTGACGCCGTGGGGCGGCAGCGTATGGTCGTCGCATAGCCTGCTCGTGTCGTTCCACAACGAGACG
TGGGGCGGCGAGAAGTTCTTCCATCTGCTCGAGCGGCTGTCGCAGCAGCCGCGCCAGCATCTCGACCTGC
TCGAGCTGCTGTACTTCTGCCTCGCGCTCGGCTTCGAGGGGCGCTACCGCGTGCTCGACAACGGCCGCGC
GCAGCTCGACGCGGTGCGCCGCCAGCTCGCGCAGACGATCCGCTCGGTGCGCGGCGAATTCGATCCGGCG
CTCTCGCCGCATTGGCGCGACGTCGTCACGCGCGACGTCACGCGGCGCTTCACGGTGCCGCTGTGGGTGT
GCGTCGCGCTTGCGCTGCTCGTGGGCTTCGGCGTGTTCGCGGGGCTGCGCATCGCGCTCGCCGGCCATTC
GGATCGGCTGTTCGCGTCGATCGACGCGCTGCACGTGCCGAAGCTGCAGCCGGCGCCGCCCGCGCCGCAT
CCGGCGCCCGCGCCGCGCGTCGCGAAGTTCCTCGAGCCGGAGATCGCCGCGGGGCTCGTGAGCGTGCGCG
ACGAGGCCGACCGCAGCGTGATCGTGCTGCGCGGCGACGGCCTGTTCGGCTCCGGCTCGACGTCGGTGAT
CGATCGCTACATGCCGGTGCTCACGCGCGTGGCCGACGCGCTGAACCAGGTGCAGGGCAACGTGCGCGTG
AGCGGCTACACCGACGACACGCCGGTGCACACCGCGCGCTTCGCGTCGAACTGGGATTTGTCGCGCGAGC
GCGCGCAGGCGGTCCGCAGCCTGATCGCCGCGCGGCTCGACCGCCCCGAGCGGATCACCGCCGAAGGGCG
CGGCACGCTCGATCCCGTCGCGCCGAACGATTCGCCCGCGAACCGCGCGCGCAACCGGCGCGTCGAGATC
ACGCTGATGCTCGCGCCCGGCAGCGACGCCGCGCGCGCGACGAAGGAGGCGCCCTGA