SecReT6
Protein ID: 126447328
SecReT6 ID191
T6SS typei1
Gene symbolvirG
Locus tagBMA10247_A1669
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1607621..1608358 [-]
ProductDNA-binding response regulator
NoteVirG
UniProt IDA3MF16
KEGG IDbmn:BMA10247_A1669
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 1.50E-20, Aligned region: 10..117
Trans_reg_C [PF00486], Evalue: 9.70E-20, Aligned region: 161..235
Protein Sequence: 245 a.a.     [Download]
>gi|126447328|ref|YP_001078852.1| DNA-binding response regulator [Burkholderia mallei NCTC 10247]
MTNVTRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVL
LRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRA
YRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWR
LRKKIEKDPKHPELIRTERGVGYYFDAKEVETLWG
 
Nucleotide Sequence: 738 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c1608358-1607621 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGACGAATGTGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAACCGTTGCGGCGCGTGCTTT
GCAATTACCTGTCGGGCCACGGGATGGCCGTGGACGGCGTGGGAACGGCGGCAGCGGCCGCCGAATCGGT
CGGGCGGCGCGAATACGAGATGGTGCTGCTCGATCTCGGCCTGCCGGACGGCGACGGCATCGACGTGCTG
CTGCGCTGGCGCGAAACGCAGCGCTTTCCGCTCATCTGCGTGACGGGGCGCAGCGAAGAGGCCGATCGCA
TCATGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAAGCCGTACTCGCTGCGCGAGGTGCTCGCCCG
GATGCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACGACGCCCGTGCGGCGCGGCAGGCATCCGCGTGCG
TACCGCTTCGACGGATGGACGCTGAACATGAACACGCGCCGGCTGTTGACGCGCGATGCGCAGGAAATTC
CGCTGACGGTCGGCGAATTCAACCTGCTCGCGTTCTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGCGC
GCAGTTGCTCGAGTGCACGCGTGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGG
CTGCGCAAGAAAATCGAGAAGGATCCGAAGCATCCCGAACTGATTCGAACCGAGCGGGGCGTCGGCTACT
ACTTCGACGCGAAAGAGGTGGAGACGCTATGGGGATGA