SecReT6
Protein ID: 126447347
SecReT6 ID193
T6SS typei3
Gene symbol-
Locus tagBMA10247_A2176
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]2113219..2114304 [-]
ProductSciB protein
NoteTssG
UniProt IDA3MGG1
KEGG IDbmn:BMA10247_A2176
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-100, Aligned region: 24..325
Protein Sequence: 361 a.a.     [Download]
>gi|126447347|ref|YP_001079347.1| SciB protein [Burkholderia mallei NCTC 10247]
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFRLGQQPSLAFA
PREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWA
SAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHARLSASPHLVREARNADGLRMTLERYFGVPV
TLEENVFHWIAVDPLEHSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPR
LVEWVRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWWGWLGRSPSGEPVTGMRFEPEHYAHGFARGT
ARDTRGMRGER
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|126445587|ref|NC_009079.1|:c2114304-2113219 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGGCGCGCGACATGACGCAGGCGGCCGTTGCCGACACGGCGCTGTCGCCGCAAGCGCTCGCGCGGCTGC
GCGCCGAACCGTGGCGCTATGGGTTCCTCGCGCTGCTGCGCCGCATCGGCGCGGATGCGCGCATCGATCC
GATCGGCAAGGCGAGGCGCCCGCAGGCGGAGCCGTTTCGCCTCGGCCAGCAGCCGAGCCTCGCGTTCGCG
CCGCGCGAGATCGCCAGCGTCGGCGACGCGAACGGGCGGCTCAAGGTGCGGCTGTTCGGGCTCGGGATGC
TGGGGCCGAACGGGCCGCTGCCGATCCACGTGACGGAGATCGCGCGCGATCGCGAGGAGAGCCGGCGCGA
TCCGACGCTCGGCAATTTTCTCGATATCTTCCATCATCGCTATCTGACGCTGCTGTATCGCGCGTGGGCG
TCGGCGCAGGCGGCGGCCGGCCTCGATCGTCCGGATGACGAACGGTTTTCGTTCTACGTCGCGAGCCTCG
CCGGCCAGGATCTCGACGAGGTCGGCGCGCGGCCGCTGCCCGCGCACGCGCGGCTGTCCGCCTCGCCGCA
TCTGGTGCGCGAGGCGCGCAACGCGGACGGCCTGCGAATGACGCTCGAACGTTACTTCGGCGTGCCGGTG
ACGCTGGAGGAAAACGTATTTCACTGGATCGCCGTCGATCCGCTCGAGCACAGCCGGCTCGGCCGGCCCG
GCGACGCATCGACGATGGCCGCGGGCGCGCTGCTCGGCGAGCTGGTGCCGGATCGGCAGCACAAGTTCCG
GCTCGTGTTCGGGCCGCTCGACATCGACGCCTATCTGCGCTTCACGCCGCGGGGCGAGGATCTGCCGCGG
CTCGTCGAATGGGTGCGGGCGTTCGTCGGCTACGAGTTCGAGTGGGAGCTCGAGTTGCGGATCAAGCCGA
ACGGCGCGCCGCCCGCCGTGATGGGCGGCCCGCATCAACTCGGCTGGTGGGGCTGGCTCGGCCGCTCGCC
GTCCGGCGAGCCGGTGACGGGCATGCGTTTCGAACCCGAGCACTATGCGCACGGGTTCGCGCGCGGCACG
GCTCGCGACACGCGCGGCATGCGAGGTGAACGATGA